CAZyme Information: MGYG000002737_00247

Basic Information

• Species: Prevotella sp900553465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900553465
• CAZyme ID: MGYG000002737_00247
• CAZy Family: GH5
• CAZyme Description: Endoglucanase C307

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	MGYG000002737_4|CGC1	41910.54	6.2627

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002737	2443712	MAG	Netherlands	Europe

• Gene Location: Start: 33811; End: 34905 Strand: -

Full Sequence      

MKHRLIILIALLLKGFVCMAGDFVPGRGVNIAHWLSQCYYKDIPREKFVTADDFKEIARQ
GFDHVRLPLDEKELWNADGTRNKEVFGILHTGIKSAIKNGLKVVVDLHIVHAHDFNAGAE
GRTNSLWDSEADQEHLCRLWEELSDELHKYSNDDVAYEIMNEPVAPDHEAWNRLVAKVYD
VIRSREKHRPIVVGSNMWQQTATFEHLRVPEGDDNIILSFHFYEPYFFTHYKAGWTEHKD
FGGTVHYPGEIVTAEELAAMTGRDRQLAEGWVTVWDRQRLKDNVMKAKKKADELGLVLYC
GEFGVYSRVPEADALRWLGDLTGVLDELGISWALWNYKDGGGFGLRNIRTGEWKTRYVDA
LMHR

Enzyme Prediction     

No EC number prediction in MGYG000002737_00247.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	28	338	3.6e-130	0.9903846153846154

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	2.09e-35	45	341	21	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.74e-13	27	362	63	391	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY36470.1	1.24e-121	13	347	63	396
AUP81187.1	2.95e-100	23	348	37	360
SMD43874.1	6.09e-100	23	362	34	365
ACB76596.1	1.48e-98	23	345	6	330
AXT60837.1	9.23e-98	1	338	1	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	5.51e-41	28	338	7	316	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	1.50e-40	28	338	7	316	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
3AMC_A	1.04e-30	24	362	11	311	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
3AMG_A	7.42e-30	24	362	11	311	Crystalstructures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8],3AMG_B Crystal structures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8]
3AZR_A	7.42e-30	24	362	11	311	DiverseSubstrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZR_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZS_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZS_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZT_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_C Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_D Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23340	4.05e-41	28	338	7	316	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
A3DJ77	4.05e-41	28	338	7	316	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P0C2S3	3.02e-40	28	338	7	316	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P16169	5.73e-36	27	331	9	287	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
P14250	1.61e-18	27	337	312	633	Endoglucanase 3 OS=Fibrobacter succinogenes (strain ATCC 19169 / S85) OX=59374 GN=cel-3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000355	0.998967	0.000185	0.000151	0.000149	0.000140

TMHMM  Annotations     

start	end
5	24