CAZyme Information: MGYG000002737_00637

Basic Information

• Species: Prevotella sp900553465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900553465
• CAZyme ID: MGYG000002737_00637
• CAZy Family: GH92
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1055	MGYG000002737_12|CGC1	120962.66	6.1806

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002737	2443712	MAG	Netherlands	Europe

• Gene Location: Start: 40743; End: 43910 Strand: -

Full Sequence      

MKQILSIVAFLLLSMNATAANHVLFEIGKKDGAASEFALAPDQYKKFLMKNSGVKTYYIG
YSDAGKDWPYAFPGPQDGWGGGGYWSGYHPRHFPVIQFELEKLAQEGSCSLVISFAGINN
ISTTRWRVEINGHRFEKDFKGRSSAKMLKGEEKAAPEEWTIEFPVGWLKKGMNRIQLGII
KGYWCVFDQIKLNTPDKCRLKKATSSLIRSVKAAPFEYKRDGKYYQPVLVDMIQYDKART
LTFETKGMKSCTRKIEPGESIQEILLPAVKGKRTQTFRIKADNEVIFTGKIERSHQPLHT
YADYVDLLMGTGNSRWMFKPSPTLPLAMVQIAPDNQDEIWKAGYEYSIENIMGFNHFCDW
TMTGFIMQPTCGQLQVNPGREDFPDEGYRSRIDKATEDARVGKYSVYMTDTHIKAEITST
RRTAMQRYTFPERDDSRILIDLFAPNEYPHNLKEAVVTKQSDSEICGYATYYNAFTGYSL
EQEYTLYFVLQFSKPFESMNGWTNDSVKAVTGYIGNWNRNHEFSSKPEILTNISELKGKG
DAGVFLNFKTKEGEEIIVRSGVSLVDIDGARKNLEQEINVPFGWDFEKVVQNARSVWDDY
LGRIEIETDDYLQKRKFYTNLYRALSAKAIWSDVDGRFRDEREQIRQLSQPDDCIVSGEY
WNTFWDNQPLFNLITPEISSQWARSAITLYKNSGWFNTDPAGVEHTGVMVAMHVVSQILG
AWQSGIRDFDLPTAYEGLKKMLTVAPQKYEGGGTVGVEHLVPYMEYRYIPAWKGLVSNTL
EYAYDDWCLGQMALLLDKKDDYKYFDKRSENWKNLFDPETGFIRPKDDKGNWTEPFDPYH
TPGFTEGNAFNYSWFVPHHPEQLIEKVGKERFIKRLDEAMEKSSYANFNASGDDFSNYPI
NHGNETSMEVVYLFNWAGVPYLTQKWARAIQEQYYGTTPYDAYPGDEDLGQMSSWFVMSA
IGMFQMDGGCSQEPVYELGSPRYPKITIHLNGKYGRGDKFVIEAKNASKENKYIQNVTLN
GKPVNDFRILQKEVLKGGYLQIQMGDTPNRSWGAD

Enzyme Prediction     

No EC number prediction in MGYG000002737_00637.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH92	542	1048	2.4e-153	0.9938900203665988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07971	Glyco_hydro_92	0.0	569	1046	1	465	Glycosyl hydrolase family 92. Members of this family are alpha-1,2-mannosidases, enzymes which remove alpha-1,2-linked mannose residues from Man(9)(GlcNAc)(2) by hydrolysis. They are critical for the maturation of N-linked oligosaccharides and ER-associated degradation.
COG3537	COG3537	2.17e-144	296	1053	33	748	Putative alpha-1,2-mannosidase [Carbohydrate transport and metabolism].
NF035929	lectin_1	2.67e-74	302	1054	8	690	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
pfam17678	Glyco_hydro_92N	4.51e-60	304	563	1	231	Glycosyl hydrolase family 92 N-terminal domain. This domain is found at the N-terminus of family 92 glycosyl hydrolase proteins.
cd10317	RGL4_C	1.55e-13	25	192	1	160	C-terminal domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQD11667.1	0.0	1	1048	1	1052
QRO26410.1	0.0	12	1045	4	1039
ATP57432.1	0.0	1	1053	1	1057
AOW11392.1	0.0	20	1053	19	1054
QOD61199.1	0.0	24	1049	39	1061

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F8Z_A	4.30e-101	304	1053	10	718	Structureof the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F8Z_B Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F8Z_C Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F90_A Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F90_B Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F90_C Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron]
6F91_A	1.01e-98	302	1049	8	727	Structureof the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_B Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_C Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_D Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_E Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_F Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_G Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_H Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F92_A Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F92_B Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F92_C Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F92_D Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron]
2WZS_A	2.17e-89	301	1053	3	723	Structureof the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_B Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_C Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_D Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_E Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_F Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_G Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_H Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482]
2WVZ_A	2.48e-89	301	1053	3	723	Structureof the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WVZ_B Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WVZ_C Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WVZ_D Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW0_A Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW0_B Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW0_C Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW0_D Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW0_E Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW0_F Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW0_G Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW0_H Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],2WW1_A Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Thiomannobioside [Bacteroides thetaiotaomicron VPI-5482],2WW1_B Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Thiomannobioside [Bacteroides thetaiotaomicron VPI-5482],2WW1_C Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Thiomannobioside [Bacteroides thetaiotaomicron VPI-5482],2WW1_D Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Thiomannobioside [Bacteroides thetaiotaomicron VPI-5482],2WW3_A Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with thiomannobioside [Bacteroides thetaiotaomicron VPI-5482],2WW3_B Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with thiomannobioside [Bacteroides thetaiotaomicron VPI-5482],2WW3_C Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with thiomannobioside [Bacteroides thetaiotaomicron VPI-5482],2WW3_D Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with thiomannobioside [Bacteroides thetaiotaomicron VPI-5482],2WW3_E Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with thiomannobioside [Bacteroides thetaiotaomicron VPI-5482],2WW3_F Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with thiomannobioside [Bacteroides thetaiotaomicron VPI-5482]
2WVX_B	2.61e-84	372	1053	74	723	Structureof the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O86365	1.65e-67	302	1053	42	758	Uncharacterized glycosidase Rv0584 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0584 PE=3 SV=1
D4ATR3	2.71e-39	304	1053	33	748	Uncharacterized secreted glycosidase ARB_07629 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07629 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000307	0.999013	0.000190	0.000163	0.000157	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002737_00637.