CAZyme Information: MGYG000002737_00836

Basic Information

• Species: Prevotella sp900553465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900553465
• CAZyme ID: MGYG000002737_00836
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
229		25554.79	6.2678

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002737	2443712	MAG	Netherlands	Europe

• Gene Location: Start: 28316; End: 29005 Strand: +

Full Sequence      

MARYIRVAVSEAVGKFGSGREMYVFRVPGSESYIPGDINHDGRIDENDLTSYTNYTGLRR
GDADFEGYISRGDLNGNGLIDAFDISCVGIELETGVSSRKVEPVKGSISITSDKKMYNAG
ETVVIKVSGKGLRSVNAISFALPYNQQDMEYIGTDAERLKEMRNLTNDRLHTSGQKALYP
TFVNLGEKPYIEGDGELMTIRFKAKRRFTFNLQHADGMLVDKYLNTVQF

Enzyme Prediction     

No EC number prediction in MGYG000002737_00836.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08759	Type_III_cohesin_like	4.02e-20	106	221	1	127	Cohesin domain, interaction partner of dockerin. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. Two specific calcium-dependent interactions between cohesin and dockerin appear to be essential for cellulosome assembly, type I and type II. This subfamily represents type III cohesins and closely related domains.
cd14254	Dockerin_II	7.63e-09	36	89	1	50	Type II dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type II dockerins, which are responsible for mediating attachment of the cellulosome complex to the bacterial cell wall.
cd08547	Type_II_cohesin	2.42e-07	106	228	1	123	Type II cohesin domain, interaction partner of dockerin. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type II cohesins; their interactions with dockerin mediate attachment of the cellulosome complex to the bacterial cell wall.
cd14256	Dockerin_I	1.71e-05	35	86	1	50	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam00404	Dockerin_1	8.73e-05	36	86	1	49	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24224.1	5.65e-110	2	229	1051	1278
QIL42693.1	4.30e-89	2	229	1041	1268
AIM36311.1	2.31e-88	2	229	1053	1280
ANH81141.1	2.40e-88	2	229	1059	1286
QUU06732.1	8.79e-88	2	226	1059	1283

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002737_00836.