CAZyme Information: MGYG000002737_01579

Basic Information

• Species: Prevotella sp900553465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900553465
• CAZyme ID: MGYG000002737_01579
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
670	MGYG000002737_54|CGC1	76111.03	5.6944

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002737	2443712	MAG	Netherlands	Europe

• Gene Location: Start: 4479; End: 6491 Strand: -

Full Sequence      

MALLLLLSSGFAGAQTAQVVERPDNASQSNNYVNSRAPLLQQSFIKLPVGSIRPAGWVKR
YLELQRDGLTGHLGEISAWLDKENNAWLTSGGDHGWEEVPYWLKGYSDLAYILGDKKMLD
ETKLWIEAILKSQRPDGSFGPVNMHGDKPELWAQMIALSTLQTYYEYSGDERVIKLMTDY
FKWQLTIPDDKFLEDYWENSRGGDNLYTVLWLYNRTGEKFLLDLAHKIHRNTADWCQPTS
LPNWHNVNIAECFREPATYYMLTGDKAMLHASYNVQHLIRRTFGQVPGGMFGSDENARLG
YIDPRQGVETCGMVEQMASDEIMLRFTGDPYWAENCEDVAFNTYPAAVMPDFRSLRYITS
PNMVQSDSENHSPGIANSGPFLSMNPFSSRCCQHNHSQGWPYYSENLVYATPDNGVAFVM
YAACTADVKVADNKKITVTEETNYPFDENITITIDKGKAEFPLYLRIPSWTKNAEVYVNG
EKQTVTPVSGKYYRINREWKKGDRVSLRVPMSLSMRRWQVNKNSVSVDYGPLTLSLKIKE
RYVKRDSKETAIHDSKWQKNADASQWPTTEIYADSPWNYALYLNPENALGDIEVVKKPWP
ADNFPFTLESVPLEFKAKGRQVPSWTLDATKLCGVLPDECAPKAATLDDITLVPMGAARL
RISAFPTTDK

Enzyme Prediction     

No EC number prediction in MGYG000002737_01579.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	173	534	4.1e-35	0.6978131212723658

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	4.27e-129	24	535	11	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.95e-22	95	513	57	478	Uncharacterized conserved protein, DUF1680 family [Function unknown].
smart00725	NEAT	0.008	446	512	26	84	NEAr Transporter domain.
pfam07678	A2M_comp	0.008	42	146	20	146	A-macroglobulin complement component. This family includes the complement components region of the alpha-2-macroglobulin family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNQ38172.1	5.86e-168	26	667	38	666
AEN08321.1	6.36e-167	8	669	20	667
QKW41448.1	5.17e-166	26	667	38	666
ADO72059.1	5.77e-166	6	668	8	652
AGK75525.1	7.30e-166	26	667	38	666

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	9.53e-17	98	536	78	561	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6YQH_AAA	2.66e-16	46	535	58	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
4QK0_A	4.68e-15	264	536	284	561	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5OPJ_A	1.28e-14	46	535	58	560	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	3.01e-13	245	532	247	542	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.056116	0.940678	0.002093	0.000591	0.000257	0.000226

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002737_01579.