CAZyme Information: MGYG000002743_01678

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000002743_01678
• CAZy Family: GT2
• CAZyme Description: Cellulose synthase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
267		30400.97	5.1551

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002743	1992884	MAG	Netherlands	Europe

• Gene Location: Start: 1407; End: 2210 Strand: +

Full Sequence      

MSVHELKKAKKSVVEKQGARKRDVTTFIVTAVLMVIYLLWRLLFTLPFDQGIPQMIFAIL
LLIAEAVTAFTTFELYYRKVKADSGHLVMPKILPEDYPDVDVVIATHNEPTDVLFKTANA
CTYMDYPDRSRVHVYFADDGCRKEVASLAAELGIGYIPCEDNKYAKSGNLNNALRHTTSP
LIATFDADMIPRSSFLVDTVPYFLLPRYIQDGATGAWRYRSEDELNEDLKVGLIQTPQSF
YNLDLFQFNLYAEDKIPNEQDLSLIHI

Enzyme Prediction     

No EC number prediction in MGYG000002743_01678.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	101	208	2.5e-17	0.6352941176470588

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	3.15e-46	98	262	1	143	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
PRK11498	bcsA	3.23e-35	31	262	185	401	cellulose synthase catalytic subunit; Provisional
COG1215	BcsA	4.97e-21	29	221	1	178	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	3.30e-15	102	224	1	123	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06435	CESA_NdvC_like	1.33e-12	107	253	7	138	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMF90406.1	1.52e-100	20	261	4	243
QLG37677.1	1.39e-97	21	261	5	243
QOS81892.1	1.16e-95	21	261	5	243
QZN77042.1	1.04e-92	21	261	5	243
QKS57765.1	2.06e-92	21	261	5	243

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	7.10e-25	31	262	62	288	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	7.35e-25	31	262	74	300	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	7.36e-25	31	262	75	301	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	8.62e-24	37	262	213	414	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0CW87	9.15e-28	13	262	65	290	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1
Q76KJ8	9.15e-28	13	262	65	290	Cellulose synthase 1 OS=Komagataeibacter hansenii OX=436 GN=acsAB PE=1 SV=1
Q9WX61	2.60e-27	13	262	65	290	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
Q59167	6.56e-26	17	262	65	288	Cellulose synthase 2 OS=Komagataeibacter hansenii OX=436 GN=acsAII PE=3 SV=1
P58931	7.45e-26	37	262	99	300	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
26	45
55	77