CAZyme Information: MGYG000002751_01020

Basic Information

• Species: Collinsella sp900551815
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900551815
• CAZyme ID: MGYG000002751_01020
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485	MGYG000002751_18|CGC1	55856.88	4.6505

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002751	2168377	MAG	Netherlands	Europe

• Gene Location: Start: 3489; End: 4946 Strand: +

Full Sequence      

MSNFPNDFLWGGAIASAQAEGAWNEGGKGIDTQDLRVFDATWNVQERRRNRDINMTSERF
ADALATKESEHYPFRWGIDFYHTYKEDLALMEELGLKVFRTSISWARIFPNGDDAEPNEE
GLRYYEDLFAECHRRGMKVFATILHYATPVNLVTTYGGWKSREMIDFYLRYCKALFERLG
DLVDFWLPFNEINCSRFNPWNGCCLIKDQEENYDQAIFQCTHHQFVANALAVKLCHQMIP
GSMVGGMIARFTSYPATCDPDDVMASILDENYKNYFYTDVMARGYYPSYTKRMFADLGIE
VKMEPGDVEILRENTVDFLSFSYYMSMISTDNKDYEVTSGNLLSGKKNPYLQTSDWGWQI
DPKGLRISLNQMYDRYQLPIFIAENGIGANDVVAEDGAVHDPYRIDYLREHVAQMGEAIE
DGVDLLGYTMWGIIDIVSCGTIEMNKRYGVIYVDRDEAGHGTNKRLKKDSFAWYRRCIAS
NGADL

Enzyme Prediction     

No EC number prediction in MGYG000002751_01020.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	482	4.2e-137	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	485	1	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	1	485	1	473	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	1	484	1	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	4	485	6	477	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	3.96e-160	4	485	6	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI57160.1	8.24e-273	4	485	5	486
QIJ69318.1	6.75e-272	4	485	5	486
SNV77993.1	7.20e-269	4	485	5	486
AHI54714.1	7.20e-269	4	485	5	486
AIS64182.1	7.20e-269	4	485	5	486

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	2.51e-180	4	485	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	3.91e-156	1	485	17	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
2XHY_A	3.62e-152	5	485	9	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	7.92e-149	1	485	4	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	2.25e-148	1	485	4	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	1.11e-183	4	485	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	1.33e-173	1	485	1	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P42973	5.11e-162	1	485	1	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46130	2.53e-158	3	485	6	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P11988	6.40e-153	1	485	1	462	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002751_01020.