CAZyme Information: MGYG000002752_01214

Basic Information

• Species: Collinsella sp900556605
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900556605
• CAZyme ID: MGYG000002752_01214
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase GmuD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
466	MGYG000002752_25|CGC1	54183.43	4.682

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002752	1972873	MAG	Netherlands	Europe

• Gene Location: Start: 14785; End: 16185 Strand: -

Full Sequence      

MAQYQLPRDFFFGAAMSGPQTEGQWNQGGKLENLWDTWSIQDLDSFYNRVGSYAGNDFMA
KYQEDLRILKDLDLDTYRTSIQWSRLLDANGNLNEEGAAWYHELFRASREAGLEPFVNLY
HFDMPTYLFDRGGWESREVVEAYAHYADIAFREFGQEIKYWFTFNEPIVEPEQRYQEGVW
YPQLHDYNRARTVQYHISLAHALAVANYRRAYDEGAVRADAKIGMINCFTPVYTKQNPSE
ADLEAVRMTSGINNRWWLDLITKGELPADVLDSLAEGGVKLPFRAGDQEILKQGVVDWLG
CNYYHPTRVQAPASKVDQYGLPHFADEYVWPDAVMNESRGWEIYPQGLYDFGMDCAKNYP
DLEWFVSENGIGIMDEYKNRDAEGTIQDDYRVDFVRQHLEWVAKAIAEGAKCRGYHYWAV
IDNWSWANAFKNRYGFVEVDLMDGYKRRLKKSAAWLKQVATTHVVD

Enzyme Prediction     

No EC number prediction in MGYG000002752_01214.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	462	1.1e-127	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	1.04e-154	4	462	2	452	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	6.04e-118	2	463	1	451	Glycosyl hydrolase family 1.
TIGR03356	BGL	4.23e-106	7	455	1	425	beta-galactosidase.
PRK13511	PRK13511	1.53e-99	3	466	2	469	6-phospho-beta-galactosidase; Provisional
PRK09589	celA	3.22e-61	6	462	4	471	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH70290.1	0.0	1	466	1	466
ATP54210.1	0.0	1	466	1	466
BCV18986.1	8.99e-260	1	466	1	467
AEB07579.1	1.75e-259	1	465	1	465
ACV50514.1	5.60e-258	3	466	2	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B3K_A	1.67e-112	6	461	3	457	Family1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_A Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes]
5FOO_A	2.44e-112	6	461	4	458	6-phospho-beta-glucosidase[Streptococcus pyogenes M1 GAS],5FOO_B 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_C 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_D 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_E 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_F 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS]
5NAQ_A	2.24e-106	5	459	19	471	Crystalstructure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_B Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_C Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_D Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_E Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_F Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum]
5NAV_A	3.16e-106	5	459	19	471	Crystalstructure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_B Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_C Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_D Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_E Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_F Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum]
6Z1H_A	1.58e-95	5	466	10	451	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05508	3.60e-130	3	460	6	460	6-phospho-beta-glucosidase GmuD OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuD PE=1 SV=1
P10482	4.06e-77	6	458	5	448	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
P26208	1.85e-76	1	459	1	442	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
P22073	2.61e-76	1	466	1	445	Beta-glucosidase A OS=Paenibacillus polymyxa OX=1406 GN=bglA PE=1 SV=1
C1CEE7	1.74e-75	6	466	5	468	6-phospho-beta-galactosidase OS=Streptococcus pneumoniae (strain JJA) OX=488222 GN=lacG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002752_01214.