CAZyme Information: MGYG000002753_01024

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-103
• CAZyme ID: MGYG000002753_01024
• CAZy Family: GH94
• CAZyme Description: Cyclic beta-(1,2)-glucan synthase NdvB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400		44196.5	6.1927

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002753	1488192	MAG	Netherlands	Europe

• Gene Location: Start: 1349; End: 2551 Strand: -

Full Sequence      

MCHWWHAGAGTEHGVRTRISDDLLWLPWAVCEYVEKTGDRDIFNIQYPFLAGAELEENEH
DRYQPLEAGAETGTVLEHCRRALMRVLARGVGVHGLLLIGTGDWNDAFDRVGAQGRGESV
WLTWFFAVTARRFAALVGGHAAEQLRLAADHCTRAAEDAWDGAWYRRGYYDDGRPLGSGE
SDECRIDAIAQAFAALDTHADPGRVQTALSSAVEHLFDREHNVVRLFDPPITRRTPETGY
VRSYGAGLRENGGQYTHGALWLAMALLRTGRTEEGAQILHAVLPTAHDPKRYEGEPYVLA
ADIAAGDNAGVAGWTWYTGAAGWYLRIVAEELLGLHLRGGVLYPEPRLPAGWPEAAVRWR
DGTGLLHTIRLRPDGVTVDGKPYDGGGIGKKRPKPYSQDR

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	2	388	1.4e-119	0.3716216216216216

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3459	COG3459	8.28e-103	3	381	651	1031	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	7.20e-58	13	335	118	424	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBB66089.1	6.28e-132	3	386	1995	2383
AKH43957.1	2.21e-105	1	383	2316	2711
ABC82952.1	1.03e-104	3	388	2327	2725
ACG74515.1	2.61e-104	3	388	2322	2720
ACL66712.1	3.55e-104	3	379	2327	2721

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QDE_A	1.36e-28	15	385	409	792	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]
2CQS_A	1.50e-27	12	385	433	824	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQT_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],2CQT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],3QFY_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFY_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFZ_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QFZ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus]
3AFJ_A	6.63e-27	12	385	433	824	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127],3AFJ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127]
3ACT_A	1.20e-26	12	385	433	824	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127],3ACT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127]
3ACS_A	2.92e-26	12	385	433	824	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase W488F mutant [Cellulomonas gilvus ATCC 13127],3ACS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase W488F mutant [Cellulomonas gilvus ATCC 13127]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20471	7.89e-91	3	374	2430	2808	Cyclic beta-(1,2)-glucan synthase NdvB OS=Rhizobium meliloti (strain 1021) OX=266834 GN=ndvB PE=1 SV=2
B9K7M6	4.24e-31	20	385	415	794	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000012	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002753_01024.