CAZyme Information: MGYG000002756_00105

Basic Information

• Species: Blautia sp900765525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia sp900765525
• CAZyme ID: MGYG000002756_00105
• CAZy Family: GH5
• CAZyme Description: Endoglucanase C307

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		42312.09	6.4092

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002756	3762639	MAG	Netherlands	Europe

• Gene Location: Start: 121030; End: 122115 Strand: -

Full Sequence      

MLYKEFKKGINLGGWLSQYDCLPKPPKTQQELEEHLYTFLTKKDLEQISKWGFDHIRLPV
SGYLLYNKEGRLLNKLPFHFIHQCISWCKELHLNIVLDIHDFWGNVYGAMDKPMPLLTDS
ELKQHFFSLWELLSEHLKGSRDIIIMFELLNEVSDASGHLWNRLWQETVQKIRRIDTKRW
ILVGSNGQNSVSYLPQLDITQDPNVFYNFHFYTPLSFTHQRAHFSEDMREFNQTISYPGD
LSVFGDYLRHHPQFQDKHALTANETENDKNLMERLLRDAERFALSCRTGLYCGEFGVINT
APPQDGARWISDLVHLLEQNKIGHALWNYKSLDFGLLDQKGHIVSEELVSKICDLNQNEG
N

Enzyme Prediction     

No EC number prediction in MGYG000002756_00105.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	9	334	2.8e-93	0.9968051118210862

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.27e-22	39	329	24	268	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.63e-15	4	335	49	365	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNO17286.1	2.45e-110	2	349	3	341
AJD08472.1	5.13e-80	9	349	3	333
BAA00793.1	5.20e-78	5	350	3	336
ADU73485.1	5.20e-78	5	350	3	336
ALX07407.1	5.20e-78	5	350	3	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	2.14e-78	5	350	3	336	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	6.02e-78	5	350	3	336	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
6UJE_A	9.51e-22	5	354	9	310	ChainA, Endoglucanase [Clostridioides difficile],6UJF_A Chain A, Endoglucanase [Clostridioides difficile]
3AMC_A	1.23e-18	48	338	42	296	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
3AMG_A	7.85e-18	48	338	42	296	Crystalstructures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8],3AMG_B Crystal structures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3DJ77	1.04e-78	5	350	3	336	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P23340	1.04e-78	5	350	3	336	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
P0C2S3	1.65e-77	5	350	3	336	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P16169	7.95e-43	8	309	9	273	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
P25472	2.32e-12	2	220	31	228	Endoglucanase D OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002756_00105.