CAZyme Information: MGYG000002756_01069

Basic Information

• Species: Blautia sp900765525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia sp900765525
• CAZyme ID: MGYG000002756_01069
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548	MGYG000002756_13|CGC1	62831.41	5.2412

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002756	3762639	MAG	Netherlands	Europe

• Gene Location: Start: 4498; End: 6144 Strand: -

Full Sequence      

MKKERIDLGIPHFLTIETEDWEEILPGTGVVFKTRDVILELDNPDGEKEAWTPMGIRVTS
QTSRIKYIKFRWNQPLNKKSRILGSSWERTYGDARWKGISGRDFMPWYFLASHGERTAGY
GVKVRPSAMCFWQADTRGITLILDIRCGGTGVELKGRQLLAAEVLCMEARKGTAFQAAQA
FCSLLCTDPLLPPYPVYGSNNWYYAYGNSSEEEILKDTKYLLELTKGAKNPPYMVIDDCW
QEHHRLNEYNGGPWRKGNSKFPDMGALAEKIKEKGARPGIWVRLLLNEDKEIPEEWRISH
NGCLDPSNPQALAYIQEDVECICKWGYTLIKHDFSTYDIFGRWGFEMNPFPVQDGWSFYN
RSLTSAEVVKLLYEKIYEIAAKYQTLIIGCNTMGHLGAGLMHMQRTGDDTSGVTWERTRV
MGVNTLAFVLPQHRAFYEIDADCVGIMGPIPWELNRQWADLVAKSGTPLFVSAKPGLLSE
EEKEELHQIMLEASEQKRHLLPTDWEDTDCPEIWEDEEGKVEYNWYEEAGTKARGNNTLR
YFAYNPLS

Enzyme Prediction     

No EC number prediction in MGYG000002756_01069.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	95	335	3.3e-21	0.376453488372093

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	1.01e-37	194	470	1	269	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	1.83e-08	193	347	291	446	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14792	GH27	2.00e-08	195	334	1	124	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14790	GH_D	1.08e-04	202	446	8	206	Glycoside hydrolases, clan D. This group of glycosyl hydrolase families is comprised of glycosyl hydrolase family 31 (GH31), family 36 (GH36), and family 27 (GH27). These structurally and mechanistically related protein families are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively. They have a wide range of functions including alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase, alpha-N-acetylgalactosaminidase, stachyose synthase, raffinose synthase, and alpha-1,4-glucan lyase.
PLN02692	PLN02692	1.67e-04	195	333	56	177	alpha-galactosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL19648.1	1.34e-256	1	530	19	544
QCU01578.1	3.82e-256	1	530	19	544
SNU96820.1	2.48e-255	1	544	1	540
QIB59833.1	5.42e-248	1	541	1	540
BDA09953.1	2.20e-247	1	541	1	540

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002756_01069.