CAZyme Information: MGYG000002758_01305

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381
• CAZyme ID: MGYG000002758_01305
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
468		53349.58	5.7135

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002758	2266069	MAG	Netherlands	Europe

• Gene Location: Start: 754; End: 2160 Strand: +

Full Sequence      

MISKLKKVGQIIPKNSKNIKKSKIGLGFEKLDRNVFDPEKAYDKVAEAGVKWARLQSGWA
RTEKEKGVYDFEWIDKIVNNFVERGIEPWVCLCYGNAIYNKEAEKVFGAVGCPPIFTDEQ
KKGWESYVKAFVKHFEGRVNYYEVWNEPDGKWCWKHGPNATELGLFTRDTGKYIKEVNPN
AKVIGGVICSRNLAYLSEAFETGMGDYLDFVSFHEYTNDETKVFETVEAFTELAHYYNPK
IRLIQGESGSQSRTGGHGALWSAGWTEEIQAKQLARHTIADLMSGVHFTSYFSCMDMIEA
LNGTVGDTNSYLDYGYFGVLGAEFDENGKSVGTYYKKPSYYVLQNICSIFAGDFELCKMP
LTFWNMESDLTMDHDLKRTQVVAGGFKNKSGRVFAYWYPSNILTTSVDTVTKMVFFTEYD
KFRVVDVMDGSIYEIPEEMIERKGHGVYRINDMPVKDTPLLLVTGDFI

Enzyme Prediction     

No EC number prediction in MGYG000002758_01305.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	62	223	2.6e-35	0.39211136890951276

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	1.66e-09	47	219	45	229	Glycosyl hydrolases family 39.
pfam02449	Glyco_hydro_42	2.28e-08	28	97	4	70	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
cd21510	agarase_cat	5.19e-05	127	216	86	187	alpha-beta barrel catalytic domain of agarase, such as GH86-like endo-acting agarases identified in non-marine organisms. Typically, agarases (E.C. 3.2.1.81) are found in ocean-dwelling bacteria since agarose is a principle component of red algae cell wall polysaccharides. Agarose is a linear polymer of alternating D-galactose and 3,6-anhydro-L-galactopyranose. Endo-acting agarases, such as glycoside hydrolase 16 (GH16) and GH86 hydrolyze internal beta-1,4 linkages. GH86-like endo-acting agarase of this protein family has been identified in the human intestinal bacterium Bacteroides uniformis. This acquired metabolic pathway, as demonstrated by the prevalence of agar-specific genetic cluster called polysaccharide utilization loci (PULs), varies considerably between human populations, being much more prevalent in a Japanese sample than in North America, European, or Chinese samples. Agarase activity was also identified in the non-marine bacterium Cellvibrio sp.
COG3664	XynB	0.002	45	233	14	191	Beta-xylosidase [Carbohydrate transport and metabolism].
COG3534	AbfA	0.004	139	225	165	253	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYY35369.1	2.43e-176	5	468	4	474
AVM45335.1	7.40e-165	2	467	10	477
AWI10371.1	4.17e-154	5	468	61	529
QNN22730.1	9.16e-76	2	402	44	418
QIP12697.1	5.61e-65	5	463	39	496

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PX8_A	5.97e-13	63	220	71	234	Crystalstructure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1PX8_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_A Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_C Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_D Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum]
6YYH_A	3.43e-12	69	239	100	262	Crystalstructure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYH_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYI_A Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12],6YYI_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12]
4EKJ_A	1.62e-09	45	219	51	234	ChainA, Beta-xylosidase [Caulobacter vibrioides]
4M29_A	1.62e-09	45	219	51	234	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
1W91_A	2.70e-08	66	218	74	232	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O30360	1.91e-13	66	220	74	234	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
P36906	4.18e-11	63	220	71	234	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
Q9ZFM2	1.48e-07	66	218	74	232	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002758_01305.