CAZyme Information: MGYG000002762_01893

Basic Information

• Species: CAG-485 sp900554845
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900554845
• CAZyme ID: MGYG000002762_01893
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
802	MGYG000002762_110|CGC1	89919.6	6.6838

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002762	3275168	MAG	Netherlands	Europe

• Gene Location: Start: 48; End: 2456 Strand: -

Full Sequence      

MKRILIATVICSLAFSASAKKKEGHHGYPIDPVPFTSVKVTDNFWGQRLKASREVTIPLA
FSKCEETGRYENFIKAAHPSDTIKVGGLSFDDTDVYKTIEGASYLLQTYPDKKLEHYIDS
VLVIVAAAQEPDGYLYTSRTMNPKHPHEWAGTKRWETVEDLSHEFYNLGHMVEGAIAHYQ
ATGKTNFLDIAKKYADCVCREIGDGPGQVARVPGHQIAEMALAKLYLVTGDKKYLDQAKY
FLDKRGYTSRKDKYSQAHMPVVEQDEAVGHAVRAAYMYAGMADVAALTGDSAYIKAIDRI
WDNIVGKKYYITGGIGATSNGEAFGENYELPNMSAYCETCAAIGNVYVNHRLFLLHGDSK
YYDVVERTLYNGLISGVALDGGAFFYPNPLESMGQHQRQPWFGCACCPSNIARFIPSLPG
YVYAVKNDDIYVNLYMANTGTLDVNGKKVVLSQEGNYPWNGDITIKIDRNNAGEFGLKLR
IPGWVKNQPVPSDLYYYNDNKRLGYTVKVNGVAANGTLTPDGYYTIDRKWKKGDKVEVHF
DMEPRTVVANNKVEADRGRIAVERGPIVYCAEFPDNDFEVLSAFMNQNPKFTEKYSSDKL
YGIVELSTDAQVLSYDDKGRLTSKDVKLNMIPYYAWNHRGRGQMAVWLPQQLNAARPVMP
PTKASKSKVIVSGEPSSVSSLTDGLVPKDENDRSMPYYHWWPKQGTTEWVVYEFPETQSV
GSSTVYWYDDGPWGGCRVPKSWKIYYKDQTGKWQPVTGVAKYPTVKGGANRVEFDIVNTD
GLKLEVVLPDDNSTGIFEWEVD

Enzyme Prediction     

No EC number prediction in MGYG000002762_01893.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	38	570	2.6e-209	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	37	570	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.13e-175	29	648	2	585	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG1331	YyaL	6.88e-05	221	369	419	564	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
cd04791	LanC_SerThrkinase	8.31e-04	179	324	99	255	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
COG1331	YyaL	0.001	169	300	414	563	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36182.1	0.0	1	801	1	801
QJR57394.1	0.0	1	801	1	800
QJR78977.1	0.0	1	801	1	800
AII67308.1	0.0	1	801	1	800
QJR57810.1	0.0	1	801	1	800

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	0.0	25	654	2	629	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	7.61e-149	24	651	2	648	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.17e-144	24	651	2	648	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	6.21e-104	37	649	43	695	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	2.35e-103	87	647	70	655	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.29e-102	87	647	70	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000405	0.998666	0.000393	0.000196	0.000170	0.000155

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002762_01893.