CAZyme Information: MGYG000002769_00355

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-465; CAG-465
• CAZyme ID: MGYG000002769_00355
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
597		68941	8.8562

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002769	1442874	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 4687; End: 6480 Strand: -

Full Sequence      

MDKKNSKIIHYIWFGGNPLSDLTKKCIQTWKKYLPDFEIMEWNEKTFDVNQCPFIKEAYE
QKKWAFVADYTRFKVIEEYGGIYLDTDMEITADIAEFLKKDLFMGVEDSKMINAAVVWAK
EPHNPHIKNIVDIYESKKHFNETGDLYDESVPRVLTKYFSQFGFDGEKDEIQIFDDGKVY
IYPMEYFYPLSYDYQHNKFTDNSVMIHHFDATWISPMEKFKTKMKRKNMIWVVYVIDFFI
SIKNKIKFFSNYRDITIFAVMFLTMLLAMFSIKPVDNSMYITSASIWQILGFSMVWTYIT
SKVRNIDLNRYLDDLTNVDPDAEEYKPYKLNFEQTTKFKKREKGLYIFEMLLTIIVAFLP
IIQLVNAIPSGIAIFTILSLVNIYFIHLGIKKKFKYRILELIPYAIVLGLMILVNPAMGI
ITSVATFIFIMIKLKTYKVKPKRIKSFVISYIVAAILFTALSFGISNANNIKEVNVGLNI
VSDSNVEEYNQIATQDNSAITEFNAGKQLFFNNIKNTTSNVGVLTNTLLAMSLVLVVINI
AITKKMDYIFLAVIVVANSIHLMSVSTVSVIYLTCATACVLLLITAMNVLNKALSGK

Enzyme Prediction     

No EC number prediction in MGYG000002769_00355.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	22	100	1.2e-21	0.9666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	7.71e-14	7	100	84	180	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	3.85e-11	20	103	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	9.20e-08	3	104	44	151	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.005	34	142	145	264	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAQ56421.1	3.86e-55	7	237	4	242
QJD73870.1	5.40e-55	7	247	4	245
AGF54961.1	8.78e-55	7	226	6	222
VEJ17432.1	1.99e-54	7	225	4	215
AQR93885.1	4.66e-54	7	226	6	222

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
255	272
277	299
345	362
367	389
401	432
447	466
520	542
562	584