CAZyme Information: MGYG000002770_02247

Basic Information

• Species: Catenibacterium sp900764725
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Catenibacterium; Catenibacterium sp900764725
• CAZyme ID: MGYG000002770_02247
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
238		27745.18	4.8962

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002770	2354150	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 275; End: 991 Strand: +

Full Sequence      

MACFCYYPLTSTPEDNLKAVRDEEIHQWFAVDILANGHYPSYMDRFFRENDIHLTITEED
KELLKKYSCDFVSFSYYSSSIATCKEDGQQTAGNLVVSTKNPHLKASDWGWQIDPVGLRI
MLNKMYDRTQKPVFVCENGLGAHDIMEDGFVHDPYRIEYLEQHFKQIDEAIDDGVDVIGY
IMWGVIDIVSAGSCEMEKRYGVVYVDADNLGNGTYKRYKKDSFKWYHDFIQNKHKQFN

Enzyme Prediction     

No EC number prediction in MGYG000002770_02247.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	5	233	3.8e-63	0.4755244755244755

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09593	arb	2.79e-80	6	230	244	470	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	1.10e-79	6	230	242	466	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09589	celA	2.26e-71	7	232	244	471	6-phospho-beta-glucosidase; Reviewed
COG2723	BglB	2.27e-70	7	232	229	452	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	3.87e-55	7	233	226	451	Glycosyl hydrolase family 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCL56674.1	3.71e-153	1	237	248	485
QMW73242.1	2.09e-136	1	231	245	476
QPS13501.1	2.09e-136	1	231	245	476
QQY27689.1	2.09e-136	1	231	245	476
QUN12825.1	1.65e-121	1	232	242	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	5.29e-82	7	231	238	463	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	1.23e-71	7	231	250	479	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
3QOM_A	1.24e-62	7	230	251	473	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
4F66_A	3.99e-60	1	230	240	473	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.11e-59	1	230	240	473	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	4.58e-80	7	230	238	462	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	5.61e-76	7	230	237	464	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P11988	7.32e-76	7	231	232	456	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2
P26206	1.81e-75	7	230	233	456	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
Q48409	3.91e-74	7	230	232	455	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002770_02247.