CAZyme Information: MGYG000002772_01476

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter
• CAZyme ID: MGYG000002772_01476
• CAZy Family: GH105
• CAZyme Description: 24.9 kDa protein in picA locus

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
199	MGYG000002772_204|CGC1	22904.37	4.4789

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002772	2925670	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 40; End: 639 Strand: +

Full Sequence      

MRCEKNGLYYHAYDSSRKMFWCDKVTGLSSNFWLRAEGWFAMAIADTWEIMPESMSAERD
ELKEMFCELIDAMLPYQDEESGMWYQVINLGGIKPNYLETSGSAIFAYAIMKGVRLGLLD
EKYFAYGEKAFYGICENFLNEKDGVLQLDNICLVAGLGNIDMREGTFEYYMREPIVKNDA
KGVAPLILAYTEILLRNKK

Enzyme Prediction     

No EC number prediction in MGYG000002772_01476.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	2	193	9.6e-62	0.5271084337349398

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	6.58e-51	5	195	175	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.08e-43	4	194	168	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOL34305.1	3.47e-106	1	194	181	374
QOL31037.1	4.92e-106	1	194	181	374
QIA34435.1	3.45e-103	1	198	181	378
ATP54720.1	4.89e-103	1	198	181	378
ANU47524.1	5.19e-102	1	198	178	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	3.39e-54	1	192	166	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
2GH4_A	7.68e-37	5	193	173	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
1NC5_A	9.25e-37	5	193	183	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
3K11_A	1.50e-09	5	194	244	411	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	8.59e-09	4	141	208	335	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A3U6	2.52e-42	1	195	32	230	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.52e-42	1	195	32	230	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O34559	5.06e-36	5	193	183	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
L7P9J4	4.29e-06	9	131	196	327	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002772_01476.