CAZyme Information: MGYG000002772_01630

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter
• CAZyme ID: MGYG000002772_01630
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355		38655	8.1572

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002772	2925670	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 2172; End: 3239 Strand: -

Full Sequence      

MKRIILTGGGTAGHVTPNIALIPKLRELGYDIQYIGSYNGIEKELIEPFGIPYHGISSGK
LRRYFSLQNFTDPFRVIKGFGEARKLIKGLKPDVIFSKGGFVSVPVVLAGKRCKVPVIIH
ESDMTPGLANKLAIPSAVKVCCNFPETLDALPEGKAVLTGSPIRQELLTGDKDAARKMCG
FTDEKPVILVIGGSLGAVAVNEAVRAALPELLKQFQIIHLCGKGKVDDSLKEIKGYCQFE
YIKNELRDLFALADVVISRAGANAICELLALRKPNLLIPLSARASRGDQILNAHSFERQG
FSLVIEEEQLTNATLLDAVHNLYENREQFINAMHNSGQQDPIATIIGLIEEAAAK

Enzyme Prediction     

No EC number prediction in MGYG000002772_01630.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	188	337	1.5e-41	0.9426751592356688

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12446	PRK12446	9.26e-162	1	352	1	352	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
PRK00726	murG	4.57e-150	1	355	1	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	1.72e-125	3	333	1	331	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	1.84e-110	2	355	1	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	2.76e-99	2	349	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL25011.1	8.37e-257	1	355	1	355
QRT48702.1	1.67e-208	1	355	1	355
QRT30225.1	4.41e-206	1	352	1	352
QEI31495.1	4.41e-206	1	352	1	352
QHB23989.1	4.41e-206	1	352	1	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	1.44e-39	3	315	4	314	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	5.35e-39	2	321	7	317	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
7D1I_A	4.15e-36	2	315	10	326	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9KK83	9.28e-179	1	355	1	355	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=murG PE=3 SV=1
C4Z1B5	4.01e-175	1	351	1	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4) OX=515620 GN=murG PE=3 SV=1
Q893R7	2.32e-156	2	351	3	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=murG PE=3 SV=2
Q0SRB4	5.69e-152	3	353	5	355	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=murG PE=3 SV=1
Q8XIQ1	8.08e-152	3	353	5	355	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002772_01630.