CAZyme Information: MGYG000002772_02532

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter
• CAZyme ID: MGYG000002772_02532
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368		42569.06	5.8109

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002772	2925670	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 424; End: 1530 Strand: -

Full Sequence      

MHNEEQVLSNVLDSLLKCEYDRDRLEIIPINDNSTDRTREMLDEYHRKYEFIRPLHRDCP
DRGKPVGLNDAMKLAKGEIIIVFDADYRPARNMLKQIALGFEDPQVGAVMGRVIPYNTNT
NMLTRLINLERSGGYQVDQQARYNLKTIPQYGGTVGGFRKDFLLETGGFNPKVLAEDTEL
TYRLFTNGWKVVYANSAECYEESPESWNVRGRQIRRWSRGHNEVLFRYLIPTITTPYMGL
FQKIDGLFLLFIYSVPVFLLLGWVVSLGLFFLGEMQIFSGWWVILFLGIYNSLGNFAPFF
EIGTSLIIDGLPGEALLLPLMMFNFFFYMWNISLGFWDAVVDTVTGRGVKWDKTVRFTVQ
KTEKEAEK

Enzyme Prediction     

No EC number prediction in MGYG000002772_02532.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	3	220	1.1e-31	0.9478260869565217

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	2.46e-57	1	177	5	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	3.09e-55	2	368	63	436	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06437	CESA_CaSu_A2	2.67e-41	1	220	9	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
cd06439	CESA_like_1	1.09e-31	1	220	37	248	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
PRK11204	PRK11204	7.88e-31	2	309	63	364	N-glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM08864.1	5.34e-214	1	358	57	414
QWT56260.1	2.42e-188	1	361	57	417
QNB48280.1	8.31e-186	1	357	41	397
QNP78262.1	6.14e-163	1	361	60	420
ACK42728.1	5.25e-153	1	357	32	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YV7_B	4.72e-16	2	213	51	262	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	4.76e-16	2	213	52	263	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
5EJ1_A	1.53e-09	57	225	207	379	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.59e-09	57	225	219	391	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.59e-09	57	225	220	392	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	7.94e-42	2	229	58	288	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q8LIY0	1.17e-24	1	252	241	499	Probable xyloglucan glycosyltransferase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC1 PE=3 SV=1
A2YHR9	6.98e-24	1	252	236	494	Putative xyloglucan glycosyltransferase 10 OS=Oryza sativa subsp. indica OX=39946 GN=CSLC10 PE=3 SV=1
Q84Z01	6.98e-24	1	252	236	494	Putative xyloglucan glycosyltransferase 10 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC10 PE=3 SV=1
Q6L538	6.99e-24	1	252	238	496	Probable xyloglucan glycosyltransferase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC7 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
224	241
251	273
278	300
315	337