CAZyme Information: MGYG000002773_01544

Basic Information

• Species: CAG-245 sp000435175
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-245; CAG-245 sp000435175
• CAZyme ID: MGYG000002773_01544
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
225		26562.79	10.1091

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002773	1604284	MAG	United States	North America

• Gene Location: Start: 83; End: 760 Strand: +

Full Sequence      

MPQMYLRQSPEKEMRNTILISLLLILLPVSVSAQFYTITRDSELLPTERQKEAYKHVEKD
VIKREKSKIMTKDTLIVRPDNQKKLDGNSRNSDRKASLKREQQKNVDDIIKAENQLPALT
IPNLYKEIIRNGILYPKIVLAQAILETGWFRSSVCRNKHNLFGLTNPRTGKYYEFNHWTE
SVRAYYTKVQYKYKGGNYLLWLDEIGYAEDPKYIIQLNKVFQMIR

Enzyme Prediction     

No EC number prediction in MGYG000002773_01544.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	126	223	9.6e-17	0.9296875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01832	Glucosaminidase	4.11e-16	122	186	2	78	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	1.37e-09	134	224	28	136	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
COG1705	FlgJ	2.24e-09	88	225	29	180	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	6.72e-07	140	164	186	210	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK08581	PRK08581	0.003	134	176	340	383	amidase domain-containing protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT98797.1	2.76e-146	14	225	1	212
AKA52216.1	2.84e-123	14	224	1	211
QJR77087.1	3.09e-113	14	213	1	200
ALJ41751.1	3.09e-113	14	213	1	200
QUT57866.1	2.76e-94	70	224	1	155

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000620	0.998666	0.000187	0.000166	0.000163	0.000153

TMHMM  Annotations     

start	end
17	39