CAZyme Information: MGYG000002774_01381

Basic Information

• Species: Schleiferilactobacillus harbinensis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Schleiferilactobacillus; Schleiferilactobacillus harbinensis
• CAZyme ID: MGYG000002774_01381
• CAZy Family: GH31
• CAZyme Description: Alpha-xylosidase XylQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
520	MGYG000002774_5|CGC2	58814.75	4.9486

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002774	3078759	MAG	United States	North America

• Gene Location: Start: 14343; End: 15905 Strand: +

Full Sequence      

MATVQQLHSTLQQHLTIPIHQGEYWYGGCVMDGPVYPFTQGSDYQLDMIHLNTPNQVAPA
FISTAGRALWSAQPFNLQVKGNDLEIAGRSTLYLDESGHNLKDAQQILAQQTFTLGKMPP
AEFFKLAQWNDWIELMYKQNQADVLKYAHGIVDHGFAPGIIMIDDLWAEYYGRWEFSIRK
FPDAKGMVQELHDMGFKVMVWTCPFVTPDTPEYHDLRDQHMLIEKADGTPVIREWWNGYG
ALLDLSNAKTYAWYKDALTKLQAETGVDGFKFDAGDAKFYDDDDRSVMQLSKTEQTQLWG
EFGLEFPYNEYRVNFKNQGAPLVNRLQDKSFEWGVNGLSELIPDTLTQGLLGYYYNCPDM
IGGGEYTSFLGKKGHLDQELIVRSAQCAALMAMMQFSVAPWRVLDKEHLDLCIQAAKLHH
DYADYIIALAQNAAKTGEPITRPMAYEYPETPLAFAKTQFMLGAKLLVAPVLEKGATHKT
IYFPAGKWQSIHDTHDVVTGGGEKDVPVDLSTLPAYQKID

Enzyme Prediction     

No EC number prediction in MGYG000002774_01381.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	103	518	7.2e-80	0.9695550351288056

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06592	GH31_NET37	6.51e-169	128	488	4	364	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG1501	YicI	4.34e-56	59	518	195	665	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	1.26e-52	136	518	37	437	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
PRK10426	PRK10426	4.99e-35	173	520	260	620	alpha-glucosidase; Provisional
cd06597	GH31_transferase_CtsY	1.23e-28	132	396	14	287	CtsY (cyclic tetrasaccharide-synthesizing enzyme Y)-like. CtsY is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ. CtsY and CtsZ both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsZ belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEU46637.1	0.0	1	520	1	520
QFR23543.1	0.0	1	520	1	520
QFR64946.1	0.0	1	520	1	520
AKP64058.1	6.07e-250	1	519	1	518
AYM02357.1	9.11e-242	1	519	1	519

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F7U_A	9.38e-26	120	518	393	797	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with pentasaccharide substrate [Listeria monocytogenes EGD-e]
5F7S_A	1.25e-25	182	519	368	729	Cycloalternan-degradingenzyme from Trueperella pyogenes [Trueperella pyogenes],5F7S_B Cycloalternan-degrading enzyme from Trueperella pyogenes [Trueperella pyogenes],5I0E_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with isomaltose [Trueperella pyogenes],5I0F_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with covalent intermediate [Trueperella pyogenes]
5I0G_B	7.03e-25	182	519	368	729	Cycloalternan-degradingenzyme from Trueperella pyogenes in complex with cycloalternan [Trueperella pyogenes]
5X3I_A	1.27e-24	175	516	363	729	ChainA, Glycoside hydrolase family 31 [Kribbella flavida DSM 17836],5X3I_B Chain B, Glycoside hydrolase family 31 [Kribbella flavida DSM 17836],5X3J_A Chain A, Glycoside hydrolase family 31 [Kribbella flavida DSM 17836],5X3J_B Chain B, Glycoside hydrolase family 31 [Kribbella flavida DSM 17836],5X3K_A Chain A, Glycoside hydrolase family 31 [Kribbella flavida DSM 17836],5X3K_B Chain B, Glycoside hydrolase family 31 [Kribbella flavida DSM 17836]
5I0D_A	6.68e-22	120	518	393	797	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with cycloalternan [Listeria monocytogenes EGD-e],5I0D_B Cycloalternan-forming enzyme from Listeria monocytogenes in complex with cycloalternan [Listeria monocytogenes EGD-e]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6NSJ0	9.12e-61	117	516	306	710	Myogenesis-regulating glycosidase OS=Homo sapiens OX=9606 GN=MYORG PE=1 SV=2
Q69ZQ1	9.12e-60	117	516	305	712	Myogenesis-regulating glycosidase OS=Mus musculus OX=10090 GN=Myorg PE=1 SV=2
D2PPM7	6.72e-25	175	516	343	709	1,3-alpha-isomaltosidase OS=Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399) OX=479435 GN=Kfla_1895 PE=1 SV=1
P19965	1.13e-21	230	516	391	678	SITS-binding protein OS=Tetronarce californica OX=7787 PE=1 SV=2
Q5AW25	3.96e-21	76	484	247	650	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002774_01381.