CAZyme Information: MGYG000002774_02382

Basic Information

• Species: Schleiferilactobacillus harbinensis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Schleiferilactobacillus; Schleiferilactobacillus harbinensis
• CAZyme ID: MGYG000002774_02382
• CAZy Family: GT113
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348		39059.93	4.8316

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002774	3078759	MAG	United States	North America

• Gene Location: Start: 78002; End: 79048 Strand: +

Full Sequence      

MRKWITDIIQGETTDATAQAKNDIASIGTHAGYEPLYIFQYDSNYESDQAVRSRIDGITA
AVGSNDLVVYQYPALISPRFDTFFMEQMKNRGTKLVLLIHDVELLRGTNSDRRVDEIDYF
NKADTLIVHNPIMGATLRSLGVTTPMVSQYLLDYLDDTHDWHRLFTAPKEFTKSLVLSGN
LLKSSYLIDWNQNTSISVFGFADKTIQEGLRANPQINYHGALRRDDLINQLPKGFGLAWD
SDSALGNYGSYTKYNHPHKVSLYLSHGMPVIVWNQSAVAPFITENHLGLTIGSLDEIDGL
LADLGDNEINDLLVHVNNMGILLRDGYFTTRALVAAEQQSFVGDIEFQ

Enzyme Prediction     

No EC number prediction in MGYG000002774_02382.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	10	337	1.9e-91	0.984472049689441

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	3.59e-101	1	339	1	332	sugar transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFR24169.1	4.64e-207	1	348	1	348
QEU47078.1	1.80e-204	1	348	1	348
QFR62640.1	4.23e-203	1	348	1	348
QFR61652.1	5.56e-131	1	339	1	339
QMU08517.1	8.16e-131	1	346	1	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QKW_A	1.93e-33	1	340	3	329	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	2.21e-33	1	340	11	337	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]
4W6Q_A	3.84e-32	1	336	3	325	GlycosyltransferaseC from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_B Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_C Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_D Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AEU1	4.34e-41	9	336	11	328	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1
B3XPQ7	1.75e-39	9	336	8	328	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1
A0A0H2UR93	6.98e-39	9	336	8	329	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
F8KEJ1	7.92e-38	9	336	13	333	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1
B5A7L9	1.02e-32	1	340	1	327	Glucosyltransferase 3 OS=Streptococcus parasanguinis OX=1318 GN=gtf3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002774_02382.