CAZyme Information: MGYG000002774_02799

Basic Information

• Species: Schleiferilactobacillus harbinensis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Schleiferilactobacillus; Schleiferilactobacillus harbinensis
• CAZyme ID: MGYG000002774_02799
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
857		94448.48	6.8868

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002774	3078759	MAG	United States	North America

• Gene Location: Start: 8170; End: 10743 Strand: -

Full Sequence      

MAIQITNLRVNLQSFPSDVTDDARFSWWLASDRDNDRQTAYQLRVAANGQPKPLAVTAWQ
RGHRNAGVPWPDLGPLLQPGQLYSWQVRIKNSQKEKSSWSTPAYFITALPHWSVPGIWAA
PAQAGGDTLPATQAFAFLQSPMIDLDPAGYTKVIIRLASRGADSLLSQNVDLFLNGHAVG
VGPARPQENIDGSGARAYHYNTYDVTAALVKHNQLALLATAADPQPSVHLAVIGYTVAGS
IVTLAQTGPEWTGLDGTTAFGDDGTRLRTGYFAMPAENIDMAHYPRHWWHGAAANWPAAV
VTRSSTVQDDERIMPYAAENSERQLIKNHTKVAEITPGNWLIDLGREIIGGLAVKLTSPA
AQRIVVWQGEQLTADGHVRHHLAAGPDYISQWHLVSGKNHFLTAQMKNFRYVELRGFQGT
LTPADIAGWQIAQPFPADDGRFHSNVPLLNAAYKLSRDTIAITNQDLFVDSQARERRAYE
GDLLVNSLTSYTVSRNDALARYSIDYLLDHPTWPEDYKLFNVEMVWWDYLYTGDTALLTK
RYAVLKAKLRRGPNNTDNYDPAMHLVRGTGLIDWPERERDGYVVGTYNTAFNAIYAGTYR
IMAKIATVLGEQTDMAHYENRALLVKKTLIDRLWDPAAGAFCDSLQADGTVTAHHAKHAT
AYALAYDVTDSPAMTAQMAKTVYNNGEFFGSIYFIYFILRGLIDHGYGALAENLLTNPDD
RADQKTFAAILHTLRATVTPEAWSNQHKPNLTLSHPWGASPGLTIVQGLAGIMPLQAGGY
RFSVRVQVTPGTTFQLTTPSSQGLIRLNYHEEGRTAVLALTVPMNAEAVVRTPKGPIAVD
SGTHTVSYLRPVPLDGD

Enzyme Prediction     

No EC number prediction in MGYG000002774_02799.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	333	831	1.2e-86	0.9940476190476191

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.95e-20	440	762	4	333	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	3.28e-05	334	431	2	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	0.002	771	847	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam03200	Glyco_hydro_63	0.002	600	705	263	363	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
pfam04685	DUF608	0.004	522	649	105	233	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEU48578.1	0.0	1	857	1	857
QFR63973.1	0.0	1	857	1	857
QFR22426.1	0.0	1	857	1	857
QVI31545.1	1.42e-266	7	833	13	867
ARY92375.1	2.61e-264	7	833	13	867

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	4.96e-14	341	835	440	944	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3W5M_A	2.90e-07	331	833	490	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	7.45e-47	409	828	700	1132	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2
T2KPL4	6.62e-09	2	828	29	902	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	1.58e-06	331	833	490	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002774_02799.