CAZyme Information: MGYG000002775_00248

Basic Information

• Species: Collinsella sp900540935
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900540935
• CAZyme ID: MGYG000002775_00248
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
721	MGYG000002775_3|CGC1	79120.92	4.9282

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002775	2116416	MAG	United States	North America

• Gene Location: Start: 9723; End: 11888 Strand: +

Full Sequence      

MSESIYTLRVSRAAAGAYPTISDALAAADQLYPVAEQPVMIRVDPGEYRERVEIHRSHVT
IEGETADSVRIVGSLCAKMPSEDGSGVDGTLGTFRTYTVLVDADDVRLENLTIVNDAGDG
REVGQAIALYADGDRLVVDACCIKGHQDTLFLGPLPPREAKPGGFIGPKQFAPRRVGRQY
FRRCRIEGDVDFIFGGARAYFEGCEIRSLNRDMDVNGYVTAASTPQGEPYGFVFHGCSFT
ADEGIAPGSVYLGRPWREWAQTVLLECWLGPHISLEGWWDWNKPAAHDGTLYAGGALFGP
AGDTAAWVPWAHYLTGQDSERYARDRVLAGTDGWDPEGGDGDAVETAGLSANGRTVHIET
YYEDEPALRARLKREGRSAAFTGKTPTDFEAWKAATRTRLYDIMGLSLMDRAPIEIRELN
RVRVAGSIVRTHAVLQVEHDVWMPFYLLEPSHPKLDERGLKRCYICPHGHQGAGAASIAG
VAGVPAVDDAVRKFNYDYGLRLARMGYVTVCPDARGWGYRRDWKGQGDDENSYLRGTCLN
QARMAEPLGLTVAGLNAWDNMRLIDYLETRGDIAMDDLGCFGFSGGGYMTLYLSALDPRV
RKAFVSGYLYGVDDSLLHLNGNCSCNYTPGLWRLLDMGDIASLVAPRPLLVQSCEKDHLN
GARGLANVDEQLDIVRDAYALLGKDENLLHEVCPGGHHLGVAHLAEDIEWLDSQVAEYAH
A

Enzyme Prediction     

No EC number prediction in MGYG000002775_00248.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	10	328	5.3e-78	0.9791666666666666
CE19	457	698	3.8e-26	0.5993975903614458

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	9.38e-63	6	330	81	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	4.50e-51	16	330	10	297	Pectinesterase.
PLN02773	PLN02773	3.88e-43	8	322	7	290	pectinesterase
PLN02708	PLN02708	8.25e-42	10	336	245	550	Probable pectinesterase/pectinesterase inhibitor
PLN02682	PLN02682	4.67e-41	6	319	69	352	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP54718.1	0.0	1	721	1	721
QIA34433.1	0.0	1	719	1	719
QUC03567.1	0.0	8	717	7	711
QRP39805.1	9.98e-100	8	336	18	349
ASN95501.1	9.98e-100	8	336	18	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	5.83e-28	10	313	7	280	ChainA, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	2.04e-26	33	288	55	310	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	1.28e-24	18	288	18	286	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1E_A	3.63e-24	16	278	17	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	6.64e-24	16	278	17	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GXA1	2.80e-36	10	337	260	559	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9LVQ0	3.40e-31	8	322	7	290	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q1JPL7	1.54e-29	10	320	249	529	Pectinesterase/pectinesterase inhibitor 18 OS=Arabidopsis thaliana OX=3702 GN=PME18 PE=1 SV=3
Q43062	2.69e-29	10	319	211	491	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1
O48711	4.53e-29	7	334	237	535	Probable pectinesterase/pectinesterase inhibitor 12 OS=Arabidopsis thaliana OX=3702 GN=PME12 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002775_00248.