CAZyme Information: MGYG000002775_00684

Basic Information

• Species: Collinsella sp900540935
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900540935
• CAZyme ID: MGYG000002775_00684
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
265	MGYG000002775_8|CGC2	30276.41	5.2471

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002775	2116416	MAG	United States	North America

• Gene Location: Start: 57006; End: 57803 Strand: -

Full Sequence      

MGDSLKIPKTIHYIWFGGKPLPPMAERCINSWKEHCPDYEIVRWDEDNFDSGGNRYFEEA
LAAKKWAFASDYARLKVLVEHGGIYMDTDVEVLRPLDRFLAEEAFSGFEAPTRIQTGLMA
CRKSFPLFERLLKDYDERVFVLPDGGYDEATNVEAITNACLELGLELNGEKQTVEGFTLY
PKDFFCPKDGKTRQVNLTDNTYAIHHFDGSWLPDETIAYKRAKEKFISSHPKMPYSLASG
FALLGLCIEAGSIKPYKVWTENRGR

Enzyme Prediction     

No EC number prediction in MGYG000002775_00684.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	26	101	1.7e-21	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	2.34e-22	6	133	81	212	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	8.84e-19	27	105	6	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	7.83e-10	3	135	42	191	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	8.33e-06	9	49	1	41	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam12919	TcdA_TcdB	0.004	45	113	147	215	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AST53065.1	2.99e-90	7	214	2	209
QUT95860.1	2.43e-89	7	214	2	209
BBK91625.1	6.76e-86	7	214	2	209
QJE27088.1	1.34e-84	7	214	2	209
QYR65866.1	3.53e-78	7	233	2	225

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O14084	1.55e-06	2	105	59	168	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002775_00684.