CAZyme Information: MGYG000002779_01564

Basic Information

• Species: Holdemania sp900120005
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Holdemania; Holdemania sp900120005
• CAZyme ID: MGYG000002779_01564
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438	MGYG000002779_12|CGC2	49915.12	5.5406

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002779	3078380	MAG	United States	North America

• Gene Location: Start: 74306; End: 75622 Strand: +

Full Sequence      

MTDYRLTYHLSPRRGWLNDPNGLCVHDGKIQIYYQADPDSLTGGCRKCWGHFTTTDFRHY
TDCGLAVEPVERFESHGAYSGSALSLDGQLHLFYTGNVKEPGDHDYIRSGRQHNTIHAVS
QDGLRFDQKQVVLTNADYPDFCSCHVRDPKVNPTADGYEMILGARTLDDEGCALLYRSRD
LQRWRLDAVLRSAAKMGYMWECPDLLHFDQADVLLCCPQGLERQGYHYENVYDNGYFILH
GDEARTYRTLDHGFDFYAPQTFLDPRGRRILIGWMGLPDTDYTIPTKTWMHALTLPRELR
FEDGRLKQRVIEELQAGPALTKTVRQTKAPETFVLKACPHGALTLTIDGLKLVYENGLLT
LDCSQCGCGRTQRHVELDKLDSLELYMDVSSVEIFINDGDVSLTSRCFFEGSVRNVAASC
DFTLYQAPRIEIESRDSE

Enzyme Prediction     

No EC number prediction in MGYG000002779_01564.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	9	309	1.2e-84	0.9931740614334471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	3.18e-148	15	303	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
COG1621	SacC	1.89e-125	2	409	26	459	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
TIGR01322	scrB_fam	2.30e-125	4	408	13	443	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
pfam00251	Glyco_hydro_32N	8.73e-101	9	309	1	307	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	3.90e-96	9	399	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQV06328.1	8.34e-134	3	434	20	462
QQY26690.1	3.35e-133	3	434	20	462
QMW75218.1	4.75e-133	3	434	20	462
QPS14445.1	4.75e-133	3	434	20	462
QIX89998.1	1.07e-127	3	408	30	455

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	8.20e-64	4	408	25	458	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	1.64e-54	4	411	48	463	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
6NU7_A	1.23e-53	4	421	32	475	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7BWC_A	2.35e-53	4	411	48	463	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
1UYP_A	3.31e-42	4	398	2	396	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	7.70e-83	4	408	28	453	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
Q05936	5.44e-76	2	421	31	476	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P13394	9.04e-75	7	410	39	455	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
P16553	4.75e-72	8	417	27	457	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
P27217	2.84e-71	8	411	30	440	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000010	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002779_01564.