CAZyme Information: MGYG000002783_00350

Basic Information

• Species: Prevotellamassilia sp900541335
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900541335
• CAZyme ID: MGYG000002783_00350
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1118		123927.75	6.3638

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002783	2416856	MAG	United States	North America

• Gene Location: Start: 3938; End: 7294 Strand: +

Full Sequence      

MNIKKYISLAGLLFPLGLAAQTEAQKVICDFESDKGYTKVGVYDTWENSPFRTGKLTGNV
KVCNNPMTEVDSILGFAPNDSKHVLGVQRSRYGSNTFGALVALKEPIALTFEKKYIRVKV
YTTEESRFMLIGLGKRKDRPGQSNMTEQLWETSMTKVGAGKWFDAVFPISGNPGAELHNL
LIVPDLASPHNRKSDFLFYIDEIDLSNDPTPRFTSTYYAINYDEVQVQDRGDRNLTSISF
QAAGQKAQTLDVKQGDSRKLYTKLLNKSFTAKAGQKITPTFSYKGNWMNGYVYLDVKQDG
RFNVVADGTNVTDKTDIMSFSNYNGKNSEGKATANGGNVLNPPAFTIPADLKPGIYRLRY
KVDWSEVNPGGNTSSGNSIVANGGAIVDTRLIIHEDHVTIKRGSRGTSGGLNGDVLNSKG
EKLEQEQIPFGQPYTVKVKPAPGFKFSHFLIRHGQINQDSLVYDTPQYFDVTVPGYKVKN
DTYVIPAEYVDGDVEITPYFKSTTGDTGEEGAYAINFDKTLEITRTDRKLNSFTMATSSN
ERTKVTLATGGKNLVYRSMMDTEVSVRPGDQVTTTTDYTGRAMHGYLYIDFNNDGEFSTD
LAANGKPAEGGELVAYSHYEGKNSLGETVNAGSVAVGIPVFTVPTDLPAGNYRARYKIDW
SNIDPAGQWAQGGNNQIDANGGYVVDFLLNVHPEKSDLDIRTTNGSIVGANNTGMPQKAT
FGQALGILPVAAAEGYAAKELIVRHGHDLDGDQYIMGNRQWKEDTLAITTKSLPASMMNG
EVRITADFQPSADAAYALKFFDEFDQEDGKVDLTKWSYRNRTDGVTWARFIATTPEGREM
TSSVKNGKYVAQCFANPFDAEKDNKGNKLEMISGAIHSEKTFAFTYGKVEGRMTTTPHTG
NFPAFWMMPVDGQGGWPACGEIDIWEQIDMENKSYHTIHSEWGNTHGQANNPKKSYTQNN
VVADQYHVFGFEWTDKLLTWYVDGKRVFSYAKKEGDQNALNKGQWPFDKDFYLILNQSVG
NGTWAKPHDKGFTYETLFDWVRVYQKPGQTTGVEEAVTSTLDFYIQPGKIRLVAPVRQHV
RIVDLQGRTMFNSEVQGNVDVTLPQGVYVLNGNKVLVP

Enzyme Prediction     

No EC number prediction in MGYG000002783_00350.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	802	1044	2.9e-50	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	3.13e-55	800	1044	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd08024	GH16_CCF	1.21e-22	873	1023	101	277	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
cd00413	Glyco_hydrolase_16	1.98e-22	802	1044	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02178	GH16_beta_agarase	1.15e-17	802	1045	27	258	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
COG2273	BglS	1.72e-17	787	1059	40	280	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12302.1	3.49e-146	1	785	5	778
QFQ13169.1	1.15e-109	513	1106	25	606
QUB65408.1	5.31e-69	767	1114	20	331
QUB68183.1	1.37e-68	796	1114	48	331
BBA29449.1	4.44e-67	794	1114	46	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XOF_A	1.23e-25	796	1046	24	268	ChainA, GH16 family protein [uncultured bacterium]
6XQF_A	5.65e-25	796	1046	24	268	ChainA, GH16 family protein [uncultured bacterium],6XQG_A Chain A, GH16 family protein [uncultured bacterium],6XQH_A Chain A, GH16 family protein [uncultured bacterium],6XQL_A Chain A, GH16 family protein [uncultured bacterium],6XQM_A Chain A, GH16 family protein [uncultured bacterium]
6JH5_A	6.62e-24	838	1046	40	233	Structureof Marine bacterial laminarinase [Aquimarina]
6JHJ_A	4.13e-23	838	1046	40	233	Structureof Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]
4CRQ_A	4.45e-23	838	1046	39	232	Crystalstructure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	5.21e-33	792	1047	52	290	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P23903	3.35e-19	792	1046	419	681	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
C1IE32	2.80e-11	847	1020	47	237	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
O33680	2.91e-11	819	1044	232	457	Endo-1,3-1,4-beta-glycanase ExsH OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exsH PE=1 SV=1
Q9Z3Q2	6.27e-10	773	1044	184	457	Endo-1,3-1,4-beta-glycanase EglC OS=Rhizobium meliloti (strain 1021) OX=266834 GN=eglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000420	0.998831	0.000248	0.000172	0.000166	0.000158

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002783_00350.