CAZyme Information: MGYG000002783_00640

Basic Information

• Species: Prevotellamassilia sp900541335
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900541335
• CAZyme ID: MGYG000002783_00640
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1293	MGYG000002783_8|CGC1	147412.39	5.7477

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002783	2416856	MAG	United States	North America

• Gene Location: Start: 10781; End: 14662 Strand: -

Full Sequence      

MKASIDFILAYEPQNPHIEQTITDILRCVSVERLYLVGPHEAEAKSRAEQDARLHVITSD
NLRGTKFLRQVMQRVQAKYTVMYLSPHTLELGYRALERMMQVAENTNGTLRSASPESSLM
LYTDRYDETGLHPTLDYQQGALRDDFDFGSLLLFRSSALRHFFGGERSPRFRFAALYALR
LFVSAQGKVAHLPEPLYKETETDLRASGEKQFDYVDPSNREVQQEMERACTEHLKHIGAW
LAPDEYDDLPADTHDYPVEASVIIPVRNRARTIGDAVDSALSQVTDFPFNVIVVDNHSTD
GTAEVLNRYAACAEVVVLRPERTDLGIGGCWDLAIRDERCGRYAVQLDSDDLYSGPDTLT
RIVEAFRTQRAAMVIGSYRMVNFQLETLPPGLIAHTEWTPDNGRNNALRINGLGAPRAFR
TDVLRQIGFPNTSYGEDYALGLAFSRHFRLGRIFEELYLCRRWEGNSDAALSIDKQNRNN
FYKDSLRTIELETRQAMIARWNHLADETEINAFFDRQLTLWEEAKERFEALEQQVRTRTL
PLEYGELCVQYNPSRIVSTGAKIDKKSVKARPCFLCDHNRPQAQREMPIMGSLEVLVNPF
PILPHHLTLPTRRHVPQSVHRFTHTLDRLVWQLPNYLVFYNGARSGASAPDHAHLQAGHR
GIVPIERDWKLYENHLERIYPTSREEEAELEDLGYDPKNGGIFLLKDYACPAFVVQGPAS
QSSPLLLEKLLKVMPTDDRRSEPDMNILAWRQEGGPTQEDYLIMVVFPRRKHRPDCYFAE
GKSQCIVSPGALDMGGLLITPREEDFERITPRQAQNILREVSLTEGEMSQIAKKLHSGRR
KTETHTTEETGLAEIVGEDVAVGIMQTTELHFTLNGNFSAKGNTVCGEQTAVYRDGGVEW
NGNIYSELLLTPADEQATLTLKDVTIGIDFHWEQREAQTFHGCLRLIVDEEKLVVINELP
VEDYLESVISSEMNASSSLELLKTHAVVSRSWVYSQMLQRRLGADKPASFFSFVRHEGEL
IRWHDRSDHQLFDVCADDHCQRYQGITRATLPTVREAVQATRGEVLMYDGKLCDARFSKC
CGGVSERYSTCWDEADYDYLSPVRDTADNAPLPDLTQESEAEAWIRQTPDSFCHTTDEHL
LAQVLNTYDQQTKDYYRWRVELTQEKLGELVEKRLNEKLGDIVDLQPVERGASGRLIKLR
VVGTEREMVIGKELEIRRLLSDTHLYSAAFIVERHEVDPQTHVPRRFVLLGAGWGHGVGM
CQIGAAVMASKGYSYRDILSHYYQHSKVKELKK

Enzyme Prediction     

No EC number prediction in MGYG000002783_00640.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	261	385	1.2e-18	0.7176470588235294

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16269	DUF4922	2.00e-92	621	828	1	187	Domain of unknown function (DUF4922). This family consists of uncharacterized proteins around 310 residues in length and is mainly found in various Bacteroides and Parabacteroides species. Several members are annotated as putative glycosyltransferases, but the specific function of this family is still unknown.
TIGR02669	SpoIID_LytB	1.97e-50	955	1284	2	261	SpoIID/LytB domain. This model describes a domain found typically in two or three proteins per genome in Cyanobacteria and Firmicutes, and sporadically in other genomes. One member is SpoIID of Bacillus subtilis. Another in B. subtilis is the C-terminal half of LytB, encoded immediately upstream of an amidase, the autolysin LytC, to which its N-terminus is homologous. Gene neighborhoods are not well conserved for members of this family, as many, such as SpoIID, are monocistronic. One early modelling-based study suggests a DNA-binding role for SpoIID, but the function of this domain is unknown. [Unknown function, General]
COG2385	SpoIID	2.43e-37	948	1292	131	394	Peptidoglycan hydrolase (amidase) enhancer domain [Cell wall/membrane/envelope biogenesis].
TIGR02870	spore_II_D	2.77e-34	947	1291	63	338	stage II sporulation protein D. Stage II sporulation protein D (SpoIID) is a protein of the endospore formation program in a number of lineages in the Firmicutes (low-GC Gram-positive bacteria). It is expressed in the mother cell compartment, under control of Sigma-E. SpoIID, along with SpoIIM and SpoIIP, is one of three major proteins involved in engulfment of the forespore by the mother cell. [Cellular processes, Sporulation and germination]
pfam08486	SpoIID	4.47e-29	950	1067	2	100	Stage II sporulation protein. This domain is found in the stage II sporulation protein SpoIID. SpoIID is necessary for membrane migration as well as for some of the earlier steps in engulfment during bacterial endospore formation. The domain is also found in amidase enhancer proteins. Amidases, like SpoIID, are cell wall hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ11638.1	0.0	21	1293	2	1262
QNT65264.1	0.0	57	1293	54	1260
QUB41125.1	0.0	56	1291	56	1242
AUI54371.1	0.0	55	1288	53	1245
QUB57862.1	0.0	55	1284	53	1240

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RWR_A	1.48e-14	944	1289	51	318	2.1Angstrom Crystal Structure of Stage II Sporulation Protein D from Bacillus anthracis [Bacillus anthracis],4RWR_B 2.1 Angstrom Crystal Structure of Stage II Sporulation Protein D from Bacillus anthracis [Bacillus anthracis]
5I1T_A	1.61e-10	958	1291	63	329	ChainA, Stage II sporulation protein D [Clostridioides difficile 630]
5TXU_A	1.92e-10	958	1291	87	353	ChainA, Stage II sporulation protein D [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C0QYX7	5.03e-12	940	1283	88	346	Uncharacterized protein BHWA1_00569 OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) OX=565034 GN=BHWA1_00569 PE=1 SV=1
P13251	9.77e-12	956	1290	73	332	Stage II sporulation protein D OS=Bacillus amyloliquefaciens OX=1390 GN=spoIID PE=4 SV=1
P07372	5.49e-10	956	1290	72	331	Stage II sporulation protein D OS=Bacillus subtilis (strain 168) OX=224308 GN=spoIID PE=4 SV=1
E0U4V7	7.39e-07	258	430	1	171	Poly(ribitol-phosphate) beta-glucosyltransferase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarQ PE=1 SV=1
Q02113	1.35e-06	965	1283	422	697	Amidase enhancer OS=Bacillus subtilis (strain 168) OX=224308 GN=lytB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000097	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002783_00640.