CAZyme Information: MGYG000002783_01378

Basic Information

• Species: Prevotellamassilia sp900541335
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900541335
• CAZyme ID: MGYG000002783_01378
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1280	MGYG000002783_35|CGC1	142351.4	6.1779

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002783	2416856	MAG	United States	North America

• Gene Location: Start: 18292; End: 22134 Strand: -

Full Sequence      

MKKSLLSLLLFVLFVPSTLVAQTFVNLTPKPKTMKTATGTLTLPANFVISHSGLDAVMKA
EVTRFAEQLNLSTGLNATVKENDETALIKIGLPITNVLTKEGAYNLTVNADGVKISTKNT
LGLYYALQTVKKILPANVMAGVKDEKITTYTLPYVTISDEPRFEYRGFMLDVSRHFFTVE
EVKRILDVMAYYKMNRFHWHLSDDQGWRVEIKKYPKLTTVGSIAPNRRFTDMKTCTQYWI
NRPYGPYFYTQEQIREVVAYAKEKHIEIIPEIDMPGHFVAAMAAYPEYSCYPEGSHVIWS
DGGISSDVLNVANPEAVQFAKDILSELIELFPYQTIHIGGDECPTSAWEGNALCQQVYRE
EKMTNYRQLQSRFIKQIGDFVKSKGRELAVWNEAISANGANLNQVTSTKPLVYCWTGPEA
AAQKAKELGLKNIYTPWGPYYINRRQGNSPLDPPGAGDGSDDVRKTYNQAIPAATDYGVQ
GTFWCEHVSDREYLEWLALPRLIAIAEAGWTPQAQRNFADFQKRMTADTVLLNYGNYRYC
KYHMLDQEAGEPKKELPLVNTAEKKYYYRLISGGTDASRKDRCIELLADDSPLLTQYADK
GAKVGTLWTNVQATANATNYEAQWWSLEEDPANKGKFALVCKAQPNGSVKATPTNTNTAG
RWIYDNTTKHYDFVLGEKAYGNIGNNHYYSIAANGQHMNSSMGGQGLAVNVYNDPLNGNG
GCWQFAPMENYTPGTPEAPITFTPLAQGKTYVITNAVEGYQATTLADDNKSPRLAHSTDA
FSGNIWTATVAGEAQTNGTQLVRLQNVATGRFISSLNNYVGREGRPVVMDATGNDLTLKY
EPATKEFRLLVDGKSVFPLPNGKVNAGSNVDANATYDAPRLQGAAWTIQEVKVATLNCVD
DLGNNLGTFKRGINVTTTELTEALCPTFENMTFQKVETKAENEYTVSYKRAAFNLTIQKV
DTKGALIENEKIAVPVGQEYTFQTPTVQYYTFESCATPDGTKLTLTKDELITVVYSTEAY
SGVKQVGEAVKEIKAGNSYLLFDASDANNNARQGYRRILANNKQVNRYAAGTQEMDPSAT
WTLVEKGENKYQVKNEYYSLFIPQLQAGKETKASATGDTFTFSLNADGETWTIKGSNNQC
WDGNENGLMVGWNAPGHPIKAFQYFVQPYFKAQVTCVNEEGQTLQQSETLDKAGATWTLV
TPTIEGYDLVSVTGNEDYEGQLDRNLDITVTYKKINTGIETVETSTANVRQGIYDLQGRK
LNRIPQPGIYIINGKKVLVK

Enzyme Prediction     

No EC number prediction in MGYG000002783_01378.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	158	513	2.9e-108	0.9762611275964391

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06563	GH20_chitobiase-like	7.59e-163	163	525	1	357	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	5.55e-128	163	512	1	345	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	2.37e-97	27	539	136	642	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06568	GH20_SpHex_like	7.73e-87	163	525	1	329	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.
cd06570	GH20_chitobiase-like_1	1.60e-75	163	525	1	311	A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12561.1	7.82e-244	1	948	4	1011
QUB42028.1	2.71e-175	1	556	1	560
AAW30398.1	2.95e-151	95	575	214	715
QUT42279.1	2.39e-137	65	544	65	545
QUT70076.1	6.54e-137	65	544	65	545

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DUP_A	9.02e-137	65	544	45	525	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_A Chain A, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
7DVB_A	4.80e-136	65	544	45	525	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_C Chain C, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_D Chain D, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
6Q63_A	3.58e-86	58	549	63	545	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]
6EZR_A	7.41e-78	95	541	202	639	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZR_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZS_A Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6EZS_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6K35_A Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi],6K35_B Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi]
6EZT_A	8.25e-77	95	541	199	636	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi],6EZT_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49008	1.91e-87	66	539	74	532	Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=nahA PE=3 SV=2
B2UQG6	8.91e-67	29	539	34	529	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1
P96155	6.49e-66	95	509	201	604	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
B2UP57	5.30e-59	103	525	59	462	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1
Q04786	2.13e-48	26	510	199	717	Beta-hexosaminidase OS=Vibrio vulnificus OX=672 GN=hex PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000252	0.999097	0.000171	0.000158	0.000147	0.000138

TMHMM  Annotations     

start	end
5	27