CAZyme Information: MGYG000002784_01337

Basic Information

• Species: Porphyromonas sp900538385
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas; Porphyromonas sp900538385
• CAZyme ID: MGYG000002784_01337
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436	MGYG000002784_32|CGC1	48179.57	6.5558

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002784	2012007	MAG	United States	North America

• Gene Location: Start: 15023; End: 16333 Strand: +

Full Sequence      

MKFTIQLEHWLISLGERLRGGQPMRRLTVLGMSLGMLVSCAGGTTTAQQLPTHLVEASER
TSDSLVRVASDWLNTLTIEEQIGQLIIPIWEPRYDAASRERYLRLIDQIHPGGILFRKGE
PYDQYRLTRLLQEHSRTPLLITADAEWGLAMRLQGTIRYPRMKLLADHCTPEEMYTLGQH
MAQQCRVMGIHVSFAPVLDVNNNPKNPVIGTRSLGATPDIVISHGLALAKGLEDGGVLSV
AKHFPGHGNTDKDSHKTLPTVSGTLEELERVELAPFRAYIEAGLGGIMVAHLSVPALEPN
VTCPSSLSHAIVTGLLREQLGFKGLIFTDGLEMRGVQRAEGLPISVAAILAGNDLLLGPL
DPPASYEELLSAYRTGTLSEETIRDRCLRILCYKLLLHVGEASERPLYNKEELYEALHTP
ELVSFAEQLQNKVSKK

Enzyme Prediction     

No EC number prediction in MGYG000002784_01337.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	133	357	1.7e-54	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	6.09e-71	77	391	1	314	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	2.04e-70	76	391	1	309	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	1.48e-47	95	357	14	278	beta-hexosaminidase; Provisional
PRK15098	PRK15098	1.57e-10	24	329	1	287	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE12612.1	4.68e-261	1	436	1	437
QUI91552.1	4.14e-118	62	429	49	415
ATS09528.1	4.14e-118	62	429	49	415
AKV63261.1	4.14e-118	62	429	49	415
AAQ65269.1	4.14e-118	62	429	49	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	3.20e-61	76	394	11	337	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3SQL_A	2.55e-58	73	390	12	342	CrystalStructure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQL_B Crystal Structure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQM_A Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_B Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_C Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_D Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002]
3BMX_A	4.05e-51	24	395	1	394	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	5.28e-50	57	395	2	368	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	8.03e-50	52	395	19	398	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	2.22e-50	24	395	1	394	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	4.69e-39	132	403	93	389	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
A9M1Z4	2.99e-37	98	374	21	303	Beta-hexosaminidase OS=Neisseria meningitidis serogroup C (strain 053442) OX=374833 GN=nagZ PE=3 SV=1
B4RQ67	5.76e-37	98	357	21	287	Beta-hexosaminidase OS=Neisseria gonorrhoeae (strain NCCP11945) OX=521006 GN=nagZ PE=3 SV=1
Q9K0Q4	1.11e-36	98	374	21	303	Beta-hexosaminidase OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.024570	0.405137	0.565975	0.000886	0.002716	0.000713

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002784_01337.