CAZyme Information: MGYG000002785_01372

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella
• CAZyme ID: MGYG000002785_01372
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
756		85836.12	5.3357

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002785	1782446	MAG	United States	North America

• Gene Location: Start: 40; End: 2310 Strand: +

Full Sequence      

MGNYDAIIIGHSQFERIPISDERQEAMLRKQIDDLEIAIQSARYEQDGGRYTVKQIEKTR
KTLMTRLEKLNQKEKKDNVVTFEELGVDHLYVDEAHSYKNAFLYTKMRNVAGIAQNEAQK
SADMFNKCQYLDEITGGKGITFATGTPISNSMTELYVMQRYLQNSKLQNMGLGLFDSWAS
TFGEVVTSIELAPEGTGYRAKSRFARFYNIPELMNMFKEIADIKTSDQLNLPVPEAEYET
VVLKPTEQQKEIVASLGERAEVVRNGGVDASVDNMLKITNDGRKLALDQRLVNELLPDDP
GSKVSVCAEKSYEIWKDTVVQKSAQIIFCDLSTPKGDGSFNVYDDLKQKLMAKGVPEKEI
AFIHDANTEAKKTELFGKVKSGQVRFLIGSTAKMGAGTNVQDRLIALHHLDIGWKPSDLE
QREGRIIRQGNHNKKVHIFRYVTESTFDSYMWQLIENKQKFISQIMTSKAPVRSCEDVDE
AALSYAEVKALATGNPAVKEKMALDVDVAKLKLLKANHMNNQYRLEDDIARNFPQQIAKL
TETIDSYKADIAHYQEHKITDPEQFSMEISGKVFTEKKEAGAALLAVCKDMKAVDAAMDI
GNYQGFNMRIQFDSWSKEFILSVKHESVSKVHLGADALGNITRINNLLESYPEKLAEAEQ
RLETVQEQLTNAKEEVGKPFTKEEELNQKLERLSELNALLNMDEREDTEAEQSESKEKEE
RPARGSIHEKLQIYKEKSQRESENGREDRKRDFGLE

Enzyme Prediction     

No EC number prediction in MGYG000002785_01372.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4646	COG4646	5.91e-28	94	292	430	635	Adenine-specific DNA methylase, N12 class [Replication, recombination and repair].
smart00490	HELICc	9.85e-06	344	430	1	82	helicase superfamily c-terminal domain.
COG0553	HepA	1.79e-05	144	466	507	843	Superfamily II DNA or RNA helicase, SNF2 family [Transcription, Replication, recombination and repair].
cd18793	SF2_C_SNF	1.31e-04	385	442	81	135	C-terminal helicase domain of the SNF family helicases. The Sucrose Non-Fermenting (SNF) family includes chromatin-remodeling factors, such as CHD proteins and SMARCA proteins, recombination proteins Rad54, and many others. They are DEAD-like helicases belonging to superfamily (SF)2, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. Similar to SF1 helicases, SF2 helicases do not form toroidal structures like SF3-6 helicases. Their helicase core consists of two similar protein domains that resemble the fold of the recombination protein RecA. This model describes the C-terminal domain, also called HelicC.
pfam00271	Helicase_C	0.005	359	430	40	109	Helicase conserved C-terminal domain. The Prosite family is restricted to DEAD/H helicases, whereas this domain family is found in a wide variety of helicases and helicase related proteins. It may be that this is not an autonomously folding unit, but an integral part of the helicase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASV45029.1	1.35e-145	2	696	2427	3186
AXF51455.1	4.00e-144	2	710	2660	3437
QIW86704.1	6.16e-143	2	696	2495	3254
QIW86628.1	6.16e-143	2	696	2495	3254
AEY69616.1	1.54e-140	2	696	2567	3330

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q71TF8	1.59e-15	3	468	967	1555	Defense against restriction protein B OS=Escherichia phage P1 OX=2886926 GN=darB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002785_01372.