CAZyme Information: MGYG000002787_00275

Basic Information

• Species: Lactiplantibacillus pentosus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactiplantibacillus; Lactiplantibacillus pentosus
• CAZyme ID: MGYG000002787_00275
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377		37363.7	9.4962

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002787	3358325	MAG	United States	North America

• Gene Location: Start: 141067; End: 142200 Strand: +

Full Sequence      

MSSIDVGLKYIRDILFGVIIIKVKVNIKQVMLGTAALAGMLVTSQAVANADSMTIKAGDT
VWAYSQKYHVSVNKIAEANGLSNPDLIIAGKTINIPGVKTGEKVTTKTTTASASSAKSTS
AATSTSQAASSTTSAAATSSSTTSASSTSQAVSSSSTAAQSSSTSTASASSVTSSASSSS
VASQASSATSTSSASQSSASQSSASQASSASTSTTATSTQSAAATSTSSQASSSASTTSS
SSTTTSATAYSASATSSSTSTTSSSTTGSASALIAAAKTYLGTPYEQMDCSAFTQAAFAK
IGRTIGRTTYAQATLGTHVSFSSAQAGDLIFWGSDSAPYHVGIYLGNGQYIASPTEGETV
SIKSTTYYTPSFAIHMF

Enzyme Prediction     

No EC number prediction in MGYG000002787_00275.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00877	NLPC_P60	8.80e-25	282	370	1	98	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
COG0791	Spr	1.63e-18	273	372	78	193	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].
PRK13914	PRK13914	8.43e-15	273	357	369	460	invasion associated endopeptidase.
NF033742	NlpC_p60_RipB	1.61e-13	289	370	116	198	NlpC/P60 family peptidoglycan endopeptidase RipB.
PRK10838	spr	3.43e-13	282	372	86	178	bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBM21980.1	7.25e-123	1	377	1	377
AYG42643.1	2.59e-114	8	377	1	372
AYJ43525.1	2.59e-114	8	377	1	372
AYG39467.1	2.59e-114	8	377	1	372
ASG81301.1	1.19e-112	8	377	1	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B8C_A	2.54e-23	277	376	35	142	Crystalstructure of NlpC/p60 domain of peptidoglycan hydrolase SagA [Enterococcus faecium]
2K1G_A	5.04e-11	282	368	25	113	SolutionNMR structure of lipoprotein spr from Escherichia coli K12. Northeast Structural Genomics target ER541-37-162 [Escherichia coli K-12]
2EVR_A	6.32e-09	282	353	130	201	ChainA, COG0791: Cell wall-associated hydrolases (invasion-associated proteins) [Nostoc punctiforme PCC 73102],2FG0_A Chain A, COG0791: Cell wall-associated hydrolases (invasion-associated proteins) [Nostoc punctiforme PCC 73102],2FG0_B Chain B, COG0791: Cell wall-associated hydrolases (invasion-associated proteins) [Nostoc punctiforme PCC 73102]
2HBW_A	2.50e-08	282	358	119	195	ChainA, NLP/P60 protein [Trichormus variabilis ATCC 29413]
4Q4T_A	1.17e-06	289	362	382	454	Structureof the Resuscitation Promoting Factor Interacting protein RipA mutated at E444 [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13692	2.91e-21	277	376	409	516	Protein P54 OS=Enterococcus faecium OX=1352 PE=3 SV=2
Q8NNK6	2.80e-11	276	367	104	200	Probable endopeptidase Cgl2188 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=Cgl2188 PE=3 SV=1
A4QFQ3	2.89e-11	276	367	106	202	Probable endopeptidase cgR_2070 OS=Corynebacterium glutamicum (strain R) OX=340322 GN=cgR_2070 PE=1 SV=1
Q01838	5.79e-10	277	357	415	502	Probable endopeptidase p60 OS=Listeria seeligeri OX=1640 GN=iap PE=3 SV=1
Q01837	7.71e-10	277	357	416	503	Probable endopeptidase p60 OS=Listeria ivanovii OX=1638 GN=iap PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.302886	0.677793	0.015724	0.002500	0.000761	0.000327

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002787_00275.