CAZyme Information: MGYG000002787_00996

Basic Information

• Species: Lactiplantibacillus pentosus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactiplantibacillus; Lactiplantibacillus pentosus
• CAZyme ID: MGYG000002787_00996
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
212	MGYG000002787_9|CGC3	24125.55	10.4316

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002787	3358325	MAG	United States	North America

• Gene Location: Start: 91151; End: 91789 Strand: -

Full Sequence      

MAKKRRRPRKRARSQLFVKKGRLQWLNILVVLMAIVGMVWFIQHNWTSATSHSTTDTLPA
TSHAAFIKKLAPAAQQLDQKYHVLASITLSQAILESDWGKSTNATENNNLFGVKSDSGRL
MTTQEYYDGAYHTVKRRFAVYDSWHASLVDHAKKLAFGTTWDSQHYAAVIKATDYKVAAK
ALQTAGYATDPSYAQKLINIIQKYDLQRYDRE

Enzyme Prediction     

No EC number prediction in MGYG000002787_00996.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	71	206	6.1e-35	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	6.39e-60	53	211	31	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	2.23e-35	57	210	154	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
smart00047	LYZ2	2.20e-32	62	210	7	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
TIGR02541	flagell_FlgJ	9.29e-32	47	203	133	292	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
PRK08581	PRK08581	1.78e-31	65	212	322	474	amidase domain-containing protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYG36847.1	1.20e-148	1	212	1	212
BBM20652.1	1.20e-148	1	212	1	212
CCC16108.1	1.20e-148	1	212	1	212
AUI79288.1	1.20e-148	1	212	1	212
AYG42476.1	1.20e-148	1	212	1	212

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.30e-23	61	210	28	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	1.58e-17	66	203	6	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	2.20e-17	66	203	6	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	4.42e-17	65	201	3	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	5.39e-17	65	201	4	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	7.47e-38	66	210	51	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P58231	1.17e-19	56	203	143	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
P75942	1.17e-19	56	203	143	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
P37710	6.23e-17	59	210	176	333	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P39046	9.46e-16	64	210	63	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999983	0.000026	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	43