CAZyme Information: MGYG000002787_01698

Basic Information

• Species: Lactiplantibacillus pentosus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactiplantibacillus; Lactiplantibacillus pentosus
• CAZyme ID: MGYG000002787_01698
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000002787_22|CGC1	39044.21	10.0119

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002787	3358325	MAG	United States	North America

• Gene Location: Start: 16518; End: 17615 Strand: +

Full Sequence      

MRLMISGGGTGGHIYPALALIDALKAHDPEAQVQFVGTHRGLESRIVPERGIDFKTIKIQ
GFKRSLSLQNVKTVYLFLKSVVTARKYIKAFKPDVVVGTGGYVSGAVVFAASQMHIPTVI
HEQNSVVGVTNKFLSRFVDKIAISFESARSQFPEQKVVMTGNPRAQQVANIKKTGALAQF
ELDPEIPTALIFGGSRGAARINAAAVEALPELDKRDYQTLFVTGQVHYDKIKDGLSATAL
APNVKIVPYIKNMPAILPEVAVILGRAGATSIAEITALGIPSILVPSPYVTNDHQTKNAQ
SLVNAGAAELIKESDLTGATLVAALDRLLQSSTHREAMAANAKKLGMPDAADQLLHVLES
VVKSH

Enzyme Prediction     

No EC number prediction in MGYG000002787_01698.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	189	350	1.4e-49	0.9872611464968153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	2.51e-162	1	364	2	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	1.21e-151	2	355	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	4.82e-120	1	364	1	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	1.93e-115	1	354	1	344	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK12446	PRK12446	1.58e-51	2	361	3	352	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYJ42273.1	2.48e-254	1	365	1	365
AYG37722.1	2.48e-254	1	365	1	365
AYG40380.1	2.48e-254	1	365	1	365
AUI78370.1	2.48e-254	1	365	1	365
CCB83320.1	2.48e-254	1	365	1	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	2.25e-49	2	361	11	365	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	8.70e-49	2	350	4	343	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	5.93e-43	2	364	8	356	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q88V81	1.19e-241	1	363	1	363	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) OX=220668 GN=murG PE=3 SV=1
Q1WTA0	8.15e-166	1	362	1	363	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Ligilactobacillus salivarius (strain UCC118) OX=362948 GN=murG PE=3 SV=1
Q03EY2	1.71e-164	1	363	1	362	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w) OX=278197 GN=murG PE=3 SV=1
Q03QH5	8.91e-158	1	361	1	361	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947) OX=387344 GN=murG PE=3 SV=1
Q38XM8	9.39e-155	4	362	1	363	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Latilactobacillus sakei subsp. sakei (strain 23K) OX=314315 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002787_01698.