CAZyme Information: MGYG000002787_01736

Basic Information

• Species: Lactiplantibacillus pentosus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactiplantibacillus; Lactiplantibacillus pentosus
• CAZyme ID: MGYG000002787_01736
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286	MGYG000002787_23|CGC1	32052.53	10.8006

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002787	3358325	MAG	United States	North America

• Gene Location: Start: 7834; End: 8694 Strand: +

Full Sequence      

MTIRGIKALLSLALGLGLLSGCQAATTATKTTSSQSSQTSRVTTKRTQKATQRHSTSQPY
RHWHSVKVVHLPILMYHSISSGNQLRVPASEFRTQMTYLKRHGYRTLTADEAVYALKTHR
VPQQKIVWVTLDDSYKDNLTAAWPILKQTNQHATINFITGFTNKKNHLTLADAQRMKASG
VVDFQSHTVRHLDLNNLTYQVQLSELTSSKKWLDQHLQQKTAVICYPAGRANQQTIRADK
QARYQYALSTAPGIATSTQSPYNLTRQRVTPGMSLTAFESLLTGIQ

Enzyme Prediction     

No EC number prediction in MGYG000002787_01736.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	122	249	1.7e-25	0.9307692307692308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10918	CE4_NodB_like_5s_6s	8.84e-46	127	272	2	157	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10969	CE4_Ecf1_like_5s	2.81e-34	91	266	3	199	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10966	CE4_yadE_5s	8.04e-27	125	278	3	164	Putative catalytic polysaccharide deacetylase domain of uncharacterized protein yadE and similar proteins. This family contains an uncharacterized protein yadE from Escherichia coli and its bacterial homologs. Although its molecular function remains unknown, yadE shows high sequence similarity with the catalytic NodB homology domain of outer membrane lipoprotein PgaB and the surface-attached protein intercellular adhesion protein IcaB. Both PgaB and IcaB are essential in bacterial biofilm formation.
pfam01522	Polysacc_deac_1	2.28e-21	125	247	7	124	Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyzes glucosidic bonds in xylan.
COG0726	CDA1	2.09e-20	71	245	1	181	Peptidoglycan/xylan/chitin deacetylase, PgdA/CDA1 family [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZY32711.1	1.16e-57	71	285	65	278
AFC32947.1	2.70e-29	69	266	33	232
AFH65258.1	2.70e-29	69	266	33	232
AQS60291.1	3.66e-23	71	270	45	261
ADG83187.1	9.14e-23	71	284	39	269

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DQ3_A	6.53e-38	69	274	7	220	ChainA, Polysaccharide deacetylase [Streptococcus pyogenes],6DQ3_B Chain B, Polysaccharide deacetylase [Streptococcus pyogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94361	1.41e-53	67	286	61	279	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
Q6G606	2.11e-14	63	282	50	280	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaB PE=3 SV=1
Q6GDD6	2.11e-14	63	282	50	280	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaB PE=3 SV=1
Q7A349	2.11e-14	63	282	50	280	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaB PE=3 SV=1
Q8NUI6	2.11e-14	63	282	50	280	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000394	0.131084	0.868053	0.000162	0.000169	0.000122

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002787_01736.