CAZyme Information: MGYG000002788_00141

Basic Information

• Species: UMGS1004 sp900548845
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UMGS1004; UMGS1004 sp900548845
• CAZyme ID: MGYG000002788_00141
• CAZy Family: GH1
• CAZyme Description: Beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297		34106.93	9.5361

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002788	1418375	MAG	United States	North America

• Gene Location: Start: 10523; End: 11416 Strand: -

Full Sequence      

MFRLYSDLVPYFATVNEPIATYIGYAKGKFAPGHKDETLGNRARHNLLVAHGRAVEAFRA
VASKSARIGIVIDVWKRYAKYPTEENLAAVRDEDERNWKFYTDPVLGGVYSDYILSALTR
EGTLMDIKEGDLARIHTPIDFFGLNIYDRVLINKGKRGAKKLLAGGNQQETRGGFDPHVI
RDVVRMLREMYSLKLPILITENGKGTYVHECSRGGTIRDKKRVNYFKAVLDEVERANEEG
LNIAGYYAWSLMDNFEWCAGTMIKYGLIHTNFRTFETKWKQSAYFYRDYIASHRTDK

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	1	293	3.9e-65	0.6456876456876457

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00232	Glyco_hydro_1	2.81e-63	1	293	149	451	Glycosyl hydrolase family 1.
COG2723	BglB	2.30e-52	1	292	152	452	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK13511	PRK13511	3.63e-38	2	287	146	460	6-phospho-beta-galactosidase; Provisional
PLN02998	PLN02998	1.96e-14	2	290	175	485	beta-glucosidase
PLN02814	PLN02814	3.64e-14	2	290	170	480	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDU23710.1	1.57e-66	1	296	150	449
AFR28760.1	9.14e-66	1	294	98	393
AHF23780.1	1.79e-60	1	293	148	443
QPI67320.1	2.29e-52	2	294	147	441
ADK47980.1	4.51e-52	2	294	147	441

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WIU_A	3.57e-53	2	294	168	462	Crystalstructure of a beta-glucosidase from Exiguobacterium marinum [Exiguobacterium sp. AT1b],6WIU_B Crystal structure of a beta-glucosidase from Exiguobacterium marinum [Exiguobacterium sp. AT1b],6WIU_C Crystal structure of a beta-glucosidase from Exiguobacterium marinum [Exiguobacterium sp. AT1b],6WIU_D Crystal structure of a beta-glucosidase from Exiguobacterium marinum [Exiguobacterium sp. AT1b],6WIU_E Crystal structure of a beta-glucosidase from Exiguobacterium marinum [Exiguobacterium sp. AT1b],6WIU_F Crystal structure of a beta-glucosidase from Exiguobacterium marinum [Exiguobacterium sp. AT1b],6WIU_G Crystal structure of a beta-glucosidase from Exiguobacterium marinum [Exiguobacterium sp. AT1b],6WIU_H Crystal structure of a beta-glucosidase from Exiguobacterium marinum [Exiguobacterium sp. AT1b],6WIU_I Crystal structure of a beta-glucosidase from Exiguobacterium marinum [Exiguobacterium sp. AT1b],6WIU_J Crystal structure of a beta-glucosidase from Exiguobacterium marinum [Exiguobacterium sp. AT1b],6WIU_K Crystal structure of a beta-glucosidase from Exiguobacterium marinum [Exiguobacterium sp. AT1b],6WIU_L Crystal structure of a beta-glucosidase from Exiguobacterium marinum [Exiguobacterium sp. AT1b],6WIU_M Crystal structure of a beta-glucosidase from Exiguobacterium marinum [Exiguobacterium sp. AT1b],6WIU_N Crystal structure of a beta-glucosidase from Exiguobacterium marinum [Exiguobacterium sp. AT1b],6WIU_O Crystal structure of a beta-glucosidase from Exiguobacterium marinum [Exiguobacterium sp. AT1b],6WIU_P Crystal structure of a beta-glucosidase from Exiguobacterium marinum [Exiguobacterium sp. AT1b]
5DT5_A	2.86e-51	2	294	170	464	Crystalstructure of the GH1 beta-glucosidase from Exiguobacterium antarcticum B7 in space group P21 [Exiguobacterium antarcticum B7],5DT5_B Crystal structure of the GH1 beta-glucosidase from Exiguobacterium antarcticum B7 in space group P21 [Exiguobacterium antarcticum B7],5DT5_C Crystal structure of the GH1 beta-glucosidase from Exiguobacterium antarcticum B7 in space group P21 [Exiguobacterium antarcticum B7],5DT5_D Crystal structure of the GH1 beta-glucosidase from Exiguobacterium antarcticum B7 in space group P21 [Exiguobacterium antarcticum B7],5DT5_E Crystal structure of the GH1 beta-glucosidase from Exiguobacterium antarcticum B7 in space group P21 [Exiguobacterium antarcticum B7],5DT5_F Crystal structure of the GH1 beta-glucosidase from Exiguobacterium antarcticum B7 in space group P21 [Exiguobacterium antarcticum B7],5DT5_G Crystal structure of the GH1 beta-glucosidase from Exiguobacterium antarcticum B7 in space group P21 [Exiguobacterium antarcticum B7],5DT5_H Crystal structure of the GH1 beta-glucosidase from Exiguobacterium antarcticum B7 in space group P21 [Exiguobacterium antarcticum B7],5DT7_A Crystal structure of the GH1 beta-glucosidase from Exiguobacterium antarcticum B7 in space group C2221 [Exiguobacterium antarcticum B7],5DT7_B Crystal structure of the GH1 beta-glucosidase from Exiguobacterium antarcticum B7 in space group C2221 [Exiguobacterium antarcticum B7],5DT7_C Crystal structure of the GH1 beta-glucosidase from Exiguobacterium antarcticum B7 in space group C2221 [Exiguobacterium antarcticum B7],5DT7_D Crystal structure of the GH1 beta-glucosidase from Exiguobacterium antarcticum B7 in space group C2221 [Exiguobacterium antarcticum B7]
4HZ6_A	5.11e-49	6	293	154	440	crystalstructure of BglB [uncultured bacterium],4HZ7_A Crystal structure of BglB with glucose [uncultured bacterium],4HZ8_A Crystal structure of BglB with natural substrate [uncultured bacterium]
6Z1H_A	6.87e-49	2	293	156	448	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
3CMJ_A	7.71e-49	6	293	175	461	ChainA, Beta-glucosidase [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26208	1.71e-46	1	293	150	446	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
Q03506	6.03e-39	1	291	150	444	Beta-glucosidase OS=Niallia circulans OX=1397 GN=bglA PE=1 SV=3
B9K7M5	7.72e-38	1	293	148	440	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2
Q08638	4.15e-37	1	293	150	442	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1
P0C946	1.56e-35	1	274	148	421	1,4-beta-D-glucan glucohydrolase (Fragment) OS=Thermotoga neapolitana OX=2337 GN=bglA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000088	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002788_00141.