CAZyme Information: MGYG000002789_01740

Basic Information

• Species: Lapidilactobacillus dextrinicus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lapidilactobacillus; Lapidilactobacillus dextrinicus
• CAZyme ID: MGYG000002789_01740
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
790	MGYG000002789_15|CGC1	90309.81	6.363

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002789	1826765	MAG	United States	North America

• Gene Location: Start: 11850; End: 14222 Strand: +

Full Sequence      

MKQYQISNWLFTHNNSQSNWQKDFNDHDWQSVTVPHDWSVHEPFSKENSSGTGYLSGGIG
YYRAHYSLKELNLTGNEILTLRFEGIYKRAEIWVNGYHLGGRPSGYSEQRFDITEFIDYS
TDSELQITVKVDHHDIADSRWYNGSGITRPVYLEIEQQVLLTPYSTKITTAALDYNSSAT
LNVTHQIENRSSRLVNIIVADSLSYTVTSDIVLTKSSALTLVPGEKQLLNYQLSVPNAKL
WSPDTPNLYCLTTTIENLTTKNKSTYKKNVGIRTIKFNPETGFYINGINEKIKGICLHED
AGCFGTAVPEQVWRRRLHQLKSAGVNAIRMSHNPHSPLLYDLCDQLGFFVFDEAFDEWEN
PKNKWWQGHNIYPPKFEGYSHDFPNWYQSDLENMILRNQQHPSIIAWSIGNEIDYPNDPY
AHPSFKEMTGNNDKNKPKTEREYNQARPDIRRLTTIANRLIEIVKNIDQTRPVTLAAAFP
ELSAKTGLLDNLDLIGYNYKEHLYSQDHQAFPNQSLIGSENSHSYSAWQAVKNNPYISGQ
FIWTGIDYLGEAAGWPIHGSGAGLLTLAGFAKEDFYLRKSWWTDTPMIHISTCQYQITDH
PDWQQTVASWDYQVGQLVDIRIYSNCNNIQLYLGDRQLDAPHYDKKHGYYQTKINYVRET
LKVIGSCNGHSVTSELLPTSSLAAIQSNLWQEPTSLNANLTKNNERIYQLELTTVDHNQQ
LVNTPIKITVNVINGHLLGLENGNLADCTTYTENYRNTFGGKLLVYFTTNNLHDVTLSLN
SELGNQIVKF

Enzyme Prediction     

No EC number prediction in MGYG000002789_01740.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	8	593	6.5e-104	0.5851063829787234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.19e-64	18	584	49	539	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	3.22e-41	22	415	66	452	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	3.42e-22	19	412	73	462	beta-galactosidase.
pfam02836	Glyco_hydro_2_C	3.72e-22	283	549	8	246	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10150	PRK10150	9.76e-22	76	475	81	447	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFR63016.1	1.01e-311	1	779	1	784
QFR24569.1	1.34e-309	1	766	1	759
QEU47483.1	1.54e-308	1	766	1	759
AYV73574.1	3.23e-289	1	782	1	787
AYV68048.1	3.23e-289	1	782	1	787

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T9A_A	5.17e-131	9	781	36	833	Crystalstructure of BuGH2Cwt [Bacteroides uniformis],5T9A_B Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_C Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_D Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9G_A Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_B Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_C Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_D Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis]
3GM8_A	9.34e-93	24	765	29	769	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
6B6L_A	4.06e-91	9	680	14	666	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	8.36e-91	9	680	14	666	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
7CWD_A	3.37e-90	24	782	28	790	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	7.95e-106	21	765	63	819	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	8.67e-77	7	762	53	788	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	1.73e-37	7	646	58	680	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	1.77e-29	9	428	12	399	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KN75	9.65e-27	9	663	35	665	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002789_01740.