CAZyme Information: MGYG000002791_00838

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Anaerotignaceae; Anaerotignum
• CAZyme ID: MGYG000002791_00838
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
276		31618.5	9.6482

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002791	1552787	MAG	United States	North America

• Gene Location: Start: 3028; End: 3858 Strand: -

Full Sequence      

MVAVGGVVRPCNGTEIHDGHVVSYRMPDQIIPCMQVLEYDRSFLAARILFDRFNGSIIIS
GAFGLFHKNTVVEAGGYDPGTIGEDMELVVKLHVFCRENSIPYRIRYATDAVCWTQAPEK
LGDLCKQRRRWHIGLFQSMMRHKRIFLNPKYGLVGLISYLYFLVYELLSPYIEVFGILTI
ALAFAVDLINVPFMILFFVIYVVYSAILSLTAFFARIYTVDLKLSFSDVLKAIGLCVVEV
SCLRLVLAWVRATALVGYRRRKHAWGRIERKKIRFK

Enzyme Prediction     

No EC number prediction in MGYG000002791_00838.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	33	186	3.4e-16	0.700507614213198

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	5.65e-17	34	218	189	374	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	1.45e-15	59	213	209	342	N-glycosyltransferase; Provisional
cd06423	CESA_like	1.64e-13	2	85	110	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam13632	Glyco_trans_2_3	9.78e-11	34	186	47	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
cd06421	CESA_CelA_like	3.59e-08	51	137	153	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCK79145.1	2.80e-128	1	276	1	276
CBL04658.1	7.03e-111	1	273	199	471
BAN78238.1	1.04e-109	1	274	197	470
QNK56534.1	5.21e-109	1	273	192	464
QUO31269.1	1.77e-101	1	272	192	463

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HCN1	1.75e-10	59	141	201	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q6G608	1.75e-10	59	141	201	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaA PE=3 SV=1
Q6GDD8	1.75e-10	59	141	201	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q7A351	1.75e-10	59	141	201	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q8NUI7	1.75e-10	59	141	201	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
146	163
167	186
193	215
230	252