CAZyme Information: MGYG000002800_00043

Basic Information

• Species: Megasphaera sp900540735
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera; Megasphaera sp900540735
• CAZyme ID: MGYG000002800_00043
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	MGYG000002800_1|CGC2	40095.8	9.5795

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002800	2598484	MAG	Peru	South America

• Gene Location: Start: 46841; End: 47953 Strand: -

Full Sequence      

MRRVIISGGGTGGHIYPAITIARAIAELEPTEFLYVGSKIGLENTLIPKEGLPFVTLDVR
GLERKLSVRNFVTLAKTAGSLVKAEMIIRKFKPDVVIGTGGFVCGPVLLAASLSGIPTLI
QEQNVIPGVTNQILSRFVNKIALGYREAAGRFKRHDILVYTGNPVRKDVLTVSKEEGRKL
LDLDPNKFTLLVAGGSRGARSINTAMIDVHKYFKHDDSIQILHITGDHEYDRVVKQLDGI
DGKGRYGEGSRIIPYLHTMPEALAAADLAVYRAGAVGLAELTVRGVPSILIPYPYAAEDH
QRYNAQALVMCGAAKMILDKMLTGKDLLDEIIHLKNEPAVLQSMAEASRALGKPEAAMDI
AKLALSIAKQ

Enzyme Prediction     

No EC number prediction in MGYG000002800_00043.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	189	356	1.4e-49	0.9936305732484076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	9.07e-144	1	369	1	356	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	1.10e-136	3	363	1	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	1.99e-112	2	370	1	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	4.27e-109	2	364	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK12446	PRK12446	8.86e-46	1	344	1	333	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCC73389.1	2.07e-231	1	370	1	370
AVO27624.1	2.07e-231	1	370	1	370
ALG42165.1	2.07e-231	1	370	1	370
AVO74788.1	2.07e-231	1	370	1	370
AXL20524.1	1.88e-228	1	370	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	5.60e-57	4	369	5	356	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	4.05e-47	2	363	10	361	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	9.00e-44	2	369	7	355	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4J2B1	7.27e-108	3	362	2	362	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Desulfotomaculum reducens (strain MI-1) OX=349161 GN=murG PE=3 SV=1
B8CWJ6	3.23e-106	3	369	2	369	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=murG PE=3 SV=1
B0K3H0	3.65e-106	3	367	2	363	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Thermoanaerobacter sp. (strain X514) OX=399726 GN=murG PE=3 SV=1
B0K8K7	3.65e-106	3	367	2	363	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=murG PE=3 SV=1
B1I4C4	9.78e-106	3	356	2	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Desulforudis audaxviator (strain MP104C) OX=477974 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002800_00043.