CAZyme Information: MGYG000002800_01744

Basic Information

• Species: Megasphaera sp900540735
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera; Megasphaera sp900540735
• CAZyme ID: MGYG000002800_01744
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
535	MGYG000002800_25|CGC1	60581.38	9.5056

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002800	2598484	MAG	Peru	South America

• Gene Location: Start: 5562; End: 7169 Strand: -

Full Sequence      

MKSRTFLGLVFVVSLLFFLIGNGSLAVTDPVESNYALTAKEMVLSGDWISPRIYGIFWYD
KPIFLYWLLCISYTIFGSTDFASRFPSAVFGAASIALAAWFMLRQTGRKPAALLLAGMTA
TSLEVWAISHSIITDQILFFFTSTTMFCTYLGLTEEKKKYIIAAYVMAGFAVLTKGPVGL
ILPGLFFLIFAGIRKNLSYVKRLFPIAGILLFLVVTLSWYGTMYLKHDMDFIDGFLGFNN
VIRATVSEHPDANVWYYYLVLIPVSLLPWSGPCLYALWKRRGNYDEYVYMVVWALGTLLF
YTAMATKYPTYSYIANMPLLYLGARLIMTLDKATRKLWCVITIPALFFWLLWWVAALVAK
APFPLGSQLWLIIFIPIATVLLIVGQWQKAYPFLPAAITLGSMVVYIILTFQVLVPFYAY
RSSTDLVPAAPTLQGKVYAFEEYSASFDYYTGITPVWTASPDFDEFSKEKRNSVWNRKHV
YPTEDGDIVAQRIKQGKTVTFIVYKSRLDSFAQSQFASLTKLAGQYGSFSIYTTK

Enzyme Prediction     

No EC number prediction in MGYG000002800_01744.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	459	9.8e-89	0.8796296296296297

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.14e-42	1	398	4	409	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	3.70e-31	1	370	2	377	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.13e-16	60	219	1	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	2.73e-09	32	188	32	195	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	7.57e-04	46	175	46	177	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXL21032.1	4.23e-246	1	534	1	536
CCC72525.1	1.58e-209	1	532	1	532
AVO73980.1	1.58e-209	1	532	1	532
ALG41393.1	3.18e-209	1	532	1	532
AVO26797.1	2.59e-208	1	532	1	532

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	5.48e-24	30	338	57	372	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1JPM4	2.40e-26	29	311	31	318	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1
A4SQX1	1.05e-24	15	336	13	339	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
B4TBG8	6.13e-24	16	370	17	373	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella heidelberg (strain SL476) OX=454169 GN=arnT PE=3 SV=1
B4ETL9	8.41e-24	7	311	14	320	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1
B7UFR9	1.48e-23	1	324	1	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) OX=574521 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.176230	0.817015	0.003095	0.001142	0.000848	0.001642

TMHMM  Annotations     

start	end
5	27
54	76
81	103
113	130
137	154
169	191
203	225
256	278
287	304
308	330
337	359
369	386
393	415