CAZyme Information: MGYG000002803_00314

Basic Information

• Species: CAG-196 sp900549855
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; CAG-196; CAG-196 sp900549855
• CAZyme ID: MGYG000002803_00314
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297	MGYG000002803_4|CGC1	35332.6	8.077

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002803	2261140	MAG	Peru	South America

• Gene Location: Start: 41408; End: 42301 Strand: +

Full Sequence      

MNTIPVVFTFDKRIVLGAAVTVKSLIDTAKPETAYDIYVYHPDIDNKTAKEFEKMLEGTN
HSIHFEYISKDRFKNAPINKGGSWTEIVYYRLLIPELLPQYDKVIYADTDVLFKDDLTEA
YNIDLTDYECAAVAMEPNNENMICHKYFPENKNELTYISSFIIFNCKKLREEKFVDKVFD
VIKTFNTRLKFFDLDTLNIACDKIYNLPYRYGVFQSLYYSDDWSKSAEYEFIKHVYSDEE
LKKEVKNVIMLHYAGKPGKPWRRKFVPKDYQEFINKIPKSLRRYTFRDFRKKLFSKV

Enzyme Prediction     

No EC number prediction in MGYG000002803_00314.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	2	263	7.7e-48	0.8832684824902723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	3.26e-54	4	262	1	247	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
COG1442	RfaJ	7.50e-33	2	262	1	245	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01501	Glyco_transf_8	2.66e-29	5	263	1	250	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
cd00505	Glyco_transf_8	1.72e-12	50	263	46	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
PRK15171	PRK15171	1.86e-09	2	261	24	270	lipopolysaccharide 3-alpha-galactosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE26627.1	1.91e-148	1	296	1	296
ANH77125.1	1.05e-145	1	296	1	296
ALB01873.1	1.05e-145	1	296	1	296
QLE78950.1	3.79e-129	2	297	3	298
QIW11491.1	3.79e-129	2	297	3	298

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6U4B_A	3.16e-15	2	277	300	583	ChainA, WbbM protein [Klebsiella pneumoniae]
1G9R_A	1.95e-08	6	263	3	254	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
1SS9_A	2.62e-08	6	263	3	254	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43974	1.97e-08	2	201	37	233	Putative glycosyltransferase HI_0258 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0258 PE=3 SV=2
P27129	4.91e-08	6	263	30	274	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002803_00314.