CAZyme Information: MGYG000002805_01615

Basic Information

• Species: CAG-488 sp900539465
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-488; CAG-488 sp900539465
• CAZyme ID: MGYG000002805_01615
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
648		74639.41	6.8657

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002805	2212369	MAG	Peru	South America

• Gene Location: Start: 48660; End: 50606 Strand: -

Full Sequence      

MQKKLPKSYETPVFLFHQGSNAKTHDFLGAHRCDDGRVVFRTWAPHAESVSVVGDFNGWD
AQKNPMKKITDGGIWEGFADGIKQFDIYKYSVLSRDGRLIMKADPYSFHAETRPATASKF
YELDGFEWSDSAWLKERKAKPAYDRPMNIYEVHAGSWKRHGDGSFYSYRELADSLCDYVK
DMGYTHVEFLPLGEYPYDGSWGYQVTGYFAPTSRYGEPKDLMYLINKFHQNGIGVILDWV
PAHFPKDAHGLYEFDGEPCYEYEDIRKGEHLQWGTKVFDYGKNEVRSFLMSSALFWIEKY
HVDGLRVDAVASMLYLDYGREDGQWVANKYGSNENLEAIDFIKKLNTVLFTEHGDILMIA
EESTAWPMVSKPVCDGGLGFNFKWNMGWMNDCLKYFSLDGYFRKFNHKNLTFSFFYAFSE
NFILPISHDEVVHGKCSLINKMPGSYEEKFASVRSFFCYLMAHPGKKLTFMGTEFGQFIE
WNYEQGLDWLLLDYEKHRQLKSFVKTLNEFYKKTPALWQNDFSWEGFEWIVSDDNSNSVI
AFRRKDKDQKEIIAVCNFTPVRRENYRIGVPFAGTYEVLLNSDDECFGGSGGGSHGVIKS
EKIPMHSQQNSIELDLPGLGALYLKCKKKNPTRKAGGKKPSANKGGKK

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	177	477	3.3e-152	0.9966777408637874
CBM48	28	109	2e-17	0.881578947368421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	2	632	1	633	1,4-alpha-glucan branching protein GlgB.
PRK14706	PRK14706	0.0	27	640	26	633	glycogen branching enzyme; Provisional
PRK14705	PRK14705	0.0	5	625	600	1221	glycogen branching enzyme; Provisional
COG0296	GlgB	0.0	6	625	4	627	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK05402	PRK05402	0.0	13	629	105	726	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI60003.1	6.63e-309	1	626	1	630
CAB1243441.1	2.41e-306	7	633	8	637
ALP95322.1	8.36e-306	2	637	4	644
QBB67031.1	4.80e-305	6	637	4	644
QNK41917.1	7.78e-305	1	637	1	640

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GQW_A	6.48e-238	6	633	127	777	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR5_A	9.17e-238	6	633	127	777	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQZ_A	9.17e-238	6	633	127	777	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQU_A	1.84e-237	6	633	127	777	Crystalstructure of branching enzyme from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQV_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltohexaose [Crocosphaera subtropica ATCC 51142],5GQY_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR2_A	3.69e-237	6	633	127	777	Crystalstructure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GR4_A Crystal structure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8CVY1	3.48e-262	1	625	1	626	1,4-alpha-glucan branching enzyme GlgB OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=glgB PE=3 SV=1
O66936	5.83e-251	3	625	2	627	1,4-alpha-glucan branching enzyme GlgB OS=Aquifex aeolicus (strain VF5) OX=224324 GN=glgB PE=3 SV=1
Q8DLB8	6.01e-247	6	625	104	749	1,4-alpha-glucan branching enzyme GlgB OS=Thermosynechococcus vestitus (strain IAM M-273 / NIES-2133 / BP-1) OX=197221 GN=glgB PE=3 SV=1
Q5NXV7	8.35e-245	10	624	12	625	1,4-alpha-glucan branching enzyme GlgB OS=Aromatoleum aromaticum (strain EbN1) OX=76114 GN=glgB PE=3 SV=1
P52981	8.88e-240	4	625	105	751	1,4-alpha-glucan branching enzyme GlgB OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002805_01615.