CAZyme Information: MGYG000002807_00485

Basic Information

• Species: Eubacterium_R sp900539165
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900539165
• CAZyme ID: MGYG000002807_00485
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642		74133.83	5.1627

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002807	1764558	MAG	Peru	South America

• Gene Location: Start: 15820; End: 17748 Strand: +

Full Sequence      

MFRLESKRIKREFKNNDGNFYASQIANTYSGMNFIPDGNGCEFVVKFVNGDELSSKGLVV
ENAGYEGDRLVFAFEESMGVKVTLKFWVHKDGNTICKQIFLSQSGDEPIDYVDLECVGII
NSKTNFSVDVVEGGEIPAFWSMLGQPVYVDSLFFGCEFPATENRIIHGNATVRYYIGSTV
GYDFACPVTVMGAGEDNTLAQVRKAFYEYIEFISVPTRLRFQYNSWYDYMKDITEENIMQ
SFAEVHKQLSAYGAPQLDSYVVDDGWPNTKAGFWSFNKKFPNKLTNVTALCNEMGSHFGL
WLGPRGGYTHPEKIAKRMQRAGNGYVNKQAYDICVASSKYVEKLGDFLIDTTDEFDIDYW
KLDGFCLKPCQNKKHDHAVGGYEDMYFVTDMWQKWIRLYEKLRATNPKLWINMTCYVNVS
PWWLQWVNSLWVQNSGDIGFAKNLEKQAQVDKEITYRDARYFDCLCKRALQIPLKNLYNH
EPIYGNTAHVDYTDDEFEKYIYWCTVRGQALNELHLSVNMMNDSKWRSLSSAMNWQKENY
HILQNAQFIGGNPEENNVYGYVAWDENGDGVVAMRNPFNEERDLTLTFNKLMGTPESLKG
ARCFNVYCKSMPENDTVYDYNSKMDLTLKPFELMIFKIAKER

Enzyme Prediction     

No EC number prediction in MGYG000002807_00485.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	9.36e-14	223	411	6	194	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	1.83e-07	181	363	250	450	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam02065	Melibiase	4.97e-06	184	304	2	126	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd06592	GH31_NET37	3.39e-04	222	312	4	85	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
cd06595	GH31_u1	0.002	223	380	16	165	glycosyl hydrolase family 31 (GH31); uncharacterized subgroup. This family represents an uncharacterized GH31 enzyme subgroup found in bacteria and eukaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT26415.1	1.68e-145	9	639	43	725
QDO70357.1	1.44e-141	9	639	43	725
ATD48595.1	4.92e-126	142	640	390	917
SQG39183.1	9.40e-126	142	640	390	917
ASY51537.1	1.30e-125	142	640	390	917

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002807_00485.