CAZyme Information: MGYG000002807_01389

Basic Information

• Species: Eubacterium_R sp900539165
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900539165
• CAZyme ID: MGYG000002807_01389
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	MGYG000002807_19|CGC1	42633.23	6.2474

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002807	1764558	MAG	Peru	South America

• Gene Location: Start: 15806; End: 16897 Strand: -

Full Sequence      

MKIAVYAIAKNEEKFVKRWYDSMKEADGIFVCDTGSTDNTASELKALGVNVKVIDVKPWR
FDDARNESLDFVDEDYDICVCTDLDEVFSKGWRDKLESIWNENATRGSYRYIWNFDENGN
PKTTFNIEKIHLRHGFKWIHPVHEVLQYSGDKKDCTVIIDSITLSHYPDTTKSRAQYLPL
LELSVKEDPEDDRNMHYLGREYLFNKEYEKAIKTLKQHLKLKSALWADERCASMRYIAKC
YNALGRNEEAYKWHLRSIAEAPHLREPYIETAIFASEQSDWYLCIYCINEALKIKTKPIS
YINEGYCWDSTPYDLLSIAYYNTEQYLLAQKYAYLAYSKSNSDSRIAENIKIINEKIKSL
RKN

Enzyme Prediction     

No EC number prediction in MGYG000002807_01389.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	4.00e-12	2	168	1	165	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
sd00006	TPR	5.99e-06	195	293	4	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
COG0463	WcaA	7.95e-06	1	256	3	254	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00535	Glycos_transf_2	1.59e-05	8	143	5	150	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
sd00006	TPR	9.93e-05	178	259	21	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQS58818.1	6.96e-132	1	356	4	359
QOX65321.1	2.72e-131	2	357	5	360
QHQ60865.1	1.41e-127	2	357	5	360
CAB1239995.1	4.31e-127	2	355	5	358
ACV63874.1	4.96e-126	2	357	5	360

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002807_01389.