CAZyme Information: MGYG000002809_01622

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium
• CAZyme ID: MGYG000002809_01622
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		34148.5	6.1291

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002809	1868435	MAG	Peru	South America

• Gene Location: Start: 369; End: 1334 Strand: -

Full Sequence      

MLTINVAPDGSGQFTTISEAVLAVPYDCPAVIRIAPGIYREKLVCEKKEITLAGAGMDAT
RLVWNDGGKLPHPDGRPTHTFRSYTAFFSGEKLRVEDMTIENDAGPGAKAGQAIAAYVDS
ARAAFSRVRLLGNQDTLFCAPLPEKEREKDGFLGPRGLAPRRASTQYYQSCEIAGDIDFI
FGGADALFEQCTLRTVNNGLAHSWVTAPSGAAAGLGFVFWDCDFVSDCPAGSIYLGRPWR
PTGKTAVLDCRLGAHIAPEGFAGWNDRTDTALAGFAEAGSTGAGAGTRPGWVQALSAAEA
AALLRTARKRCRPDDTERNIG

Enzyme Prediction     

No EC number prediction in MGYG000002809_01622.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	4	303	2.3e-76	0.9652777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	3.40e-52	6	285	87	379	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	1.09e-49	6	287	4	268	Pectinesterase.
PLN02773	PLN02773	1.78e-44	4	285	7	270	pectinesterase
PLN02682	PLN02682	3.95e-38	2	291	69	343	pectinesterase family protein
PLN02745	PLN02745	7.64e-38	6	291	289	559	Putative pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB27671.1	6.08e-226	1	318	1	318
CBL01447.1	6.08e-226	1	318	1	318
AXA81880.1	6.34e-181	1	313	1	313
QIA44050.1	3.28e-180	1	313	1	313
ATP00222.1	3.28e-180	1	313	1	313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	5.79e-26	6	287	7	271	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.07e-23	6	287	11	275	Pectinmethylesterase from Carrot [Daucus carota]
3UW0_A	1.67e-21	4	242	35	272	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	7.31e-17	14	256	18	276	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1C_A	3.10e-14	12	287	17	268	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.50e-34	4	277	7	262	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8VYZ3	9.95e-29	12	304	94	370	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q43062	3.17e-28	6	265	211	454	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1
Q9LXK7	1.02e-26	6	265	217	459	Probable pectinesterase/pectinesterase inhibitor 32 OS=Arabidopsis thaliana OX=3702 GN=PME32 PE=2 SV=1
Q8GXA1	1.25e-26	6	284	260	522	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002809_01622.