CAZyme Information: MGYG000002813_00969

Basic Information

• Species: Campylobacter_D sp900539255
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_D; Campylobacter_D sp900539255
• CAZyme ID: MGYG000002813_00969
• CAZy Family: GT66
• CAZyme Description: Undecaprenyl-diphosphooligosaccharide--protein glycotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
839	MGYG000002813_15|CGC1	95802.68	9.2262

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002813	1890992	MAG	Peru	South America

• Gene Location: Start: 11839; End: 14358 Strand: +

Full Sequence      

MAQNSALNSTNSMNSQKNASNSSQNSQASLNSKQNSQENSSQNSKNAQNSATSQKNSALN
LKNYFSFHKLKSKLKEHFARYDSFYLFLVLAYAFSVLCRLYWVWWASDFDSFKFNDSLMI
ISNDGYVFAEGARDKIAGFHQPNDLSFIDSPLAILTYFVYKLTPFSFESIILYMSVFLSS
LIVVPVLLIARIYGNLKAGFVAALLASVANSYYNRTMAGYFDTDMLVISLPMLLIYCMLR
FIIKKDALSLIAMPLIMIFYLWYYPSSYTLNCALIALFVLYALVFHRRETIFYFAGVLMM
ITLSNEAWYYESALITLLFALWGFKNEWFKLKFIIVIFVFAFVFVALSGGFNAIWYQLSF
YIFKSDVLNVAQSFAYFNVSQTIQEASNIGLSMFMQRISASELAFLLSCFGLVLLLKQHK
SFILALPMLALGFLALRGGLRFTIYAVPVMALGFGFGLFWLVSHLKKLNLDKKSLQIYAF
LTLFALLLCLGLYFALKFSIFAQLAFAMLFALIFFAFAYQKSRFAQIFVLFAGLFLSLGY
AFLHIYTYKASSVFNHNEVLILNSLKGIADREDYVVAWWDYGYPVRYYSDVKTLVDGGKH
LGKDNFFASFVLSQNERAGANLARLAVEYTEKSFYERNDTLLQSDLLKAMMRDYAAGETS
NDALIFLNSLKNPNFTLKTPKTRDIFVYMPLRMAMIFSTVASFSKIDLATGEINSPFVFS
TAMNLGALEDGSYALSNGMVLANDFTALYVSNRALKIHSITDFNSIKNKDFKQTLVDENG
DFFVFYFKENFGLPVQFIIMDKTMFESAFVQMFFFENYDRSLYELVLSEKEAKVYKLKK

Enzyme Prediction     

EC	2.4.99.19

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	87	706	7.1e-86	0.8686868686868687

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02516	STT3	4.90e-48	88	598	10	477	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
COG1287	Stt3	1.86e-38	86	704	24	620	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
pfam13231	PMT_2	0.002	158	309	12	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU80437.1	2.82e-249	73	838	3	770
APA49406.1	3.12e-249	74	838	2	712
AXL45589.1	4.42e-249	74	838	2	712
QIW73510.1	6.25e-249	74	838	2	712
QIW75062.1	6.25e-249	74	838	2	712

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OGL_A	5.05e-200	88	839	20	712	Structureof bacterial oligosaccharyltransferase PglB in complex with an acceptor peptide and an lipid-linked oligosaccharide analog [Campylobacter lari RM2100]
3RCE_A	7.22e-200	88	839	20	712	Bacterialoligosaccharyltransferase PglB [Campylobacter lari]
6GXC_A	7.22e-200	88	839	20	712	Bacterialoligosaccharyltransferase PglB in complex with an inhibitory peptide and a reactive lipid-linked oligosaccharide analog [Campylobacter lari RM2100]
3AAG_A	4.01e-88	550	837	7	289	Crystalstructure of C. jejuni pglb C-terminal domain [Campylobacter jejuni RM1221],3AAG_B Crystal structure of C. jejuni pglb C-terminal domain [Campylobacter jejuni RM1221]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HTX9	5.03e-249	74	838	2	712	Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter jejuni (strain RM1221) OX=195099 GN=pglB PE=1 SV=1
Q0P9C8	7.12e-249	74	838	2	712	Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglB PE=1 SV=1
B9KDD4	1.70e-197	73	839	2	712	Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) OX=306263 GN=pglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
83	105
170	192
225	242
262	284
291	313
333	355
403	425
440	462
474	496
500	519
526	548