CAZyme Information: MGYG000002816_02723

Basic Information

• Species: Citrobacter braakii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter; Citrobacter braakii
• CAZyme ID: MGYG000002816_02723
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000002816_7|CGC3	43740.83	6.0723

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002816	4948992	MAG	United States	North America

• Gene Location: Start: 116058; End: 117197 Strand: -

Full Sequence      

MIVYPVKHSPLLRQPEHFIARDELKALIKKVTHNLVNIHDETGEFLLRLDDGRVIDTKGW
AGWEWTHGIGLYGMYQYYQQTGDAAMRDIIDSWFADRFAEGATTKNVNTMAPFLTLAYRY
EETRNPAYLPWLDSWAEWAMHDMPRTQFGGMQHITLAEENHQQMWDDTLMMTVLPLAKIG
KLLNRPEYIEEATYQFLLHVQNLMDKETGLWFHGWSYEGQHNFANARWARGNSWLTIVIP
DFLELLDLPENNAVHRYLVQVLNAQIAALAKCQDESGLWHTLLDDPQSYLEASATAGFAY
GILKAVRKRYVGQDYAAVAEKAIRGIVQHISPEGELLHTSFGTGMGHNLDFYRNIPRTSM
PYGQAMAMLCLTEYLRKYF

Enzyme Prediction     

No EC number prediction in MGYG000002816_02723.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	60	376	9e-117	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	9.98e-145	29	379	2	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.48e-128	37	378	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASE41892.1	7.01e-293	1	379	1	379
QMR50634.1	2.85e-292	1	379	1	379
QGG14278.1	8.18e-292	1	379	1	379
AUV25939.1	2.35e-291	1	379	1	379
QKE19993.1	2.35e-291	1	379	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	2.13e-257	3	379	5	381	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.14e-243	3	379	6	382	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	1.22e-161	23	378	7	372	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	1.50e-21	63	327	23	299	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3K11_A	5.69e-18	187	352	224	387	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	2.23e-52	63	376	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P0A3U6	4.55e-10	180	324	10	160	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	4.55e-10	180	324	10	160	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002816_02723.