CAZyme Information: MGYG000002817_00025

Basic Information

• Species: Paenibacillus_B sp900539405
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_B; Paenibacillus_B sp900539405
• CAZyme ID: MGYG000002817_00025
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
692	MGYG000002817_1|CGC1	79150.9	5.1081

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002817	6425839	MAG	United States	North America

• Gene Location: Start: 30454; End: 32532 Strand: -

Full Sequence      

MKLEKSSPGRLGDLLVSEGLITASQLRSALEHQQQYGGRLGDNVVALYDVSPEAVERLTK
RTGGKGLLGEMLVQSGDITQEQLDQALEFQRKSGGILGDILLSLQMIEPGPLYRAIATQQ
QIGRIGSEYSFEQETKLPEAAARAYDAVIINKLANRYLIAVGSPLTDTQIAELEAYIDGP
IEQVLATREEMEFFWKSVYEAELMQASTDKLMEENPENSAHVTFTTPQLIFILLLAVMIV
TGLLWNWFATLIVLNIIVQVAYFAMSVFKFVITLKGTRSTAQLRFTEEELLAIDEKELPV
YTILVPMYKESNVIPHLLDNLERLDYPKSKLDVRLLIEEDDVEAQELLARMKLPAYYTVL
VVPHSLPKTKPKACNYGLIRARGDYVVIYDAEDRPDPDQLKKVFLAFRNSPSNVVCVQAK
LNYFNSDQNLMTRWFTQEYSMWFELLLPGIMKLNLPIPLGGTSNHFKTSVLKELNAWDPY
NVTEDADLGIRLYKKGYMTAIVDSRTWEEANSRVGNWIRQRSRWIKGYMQTWLVHMRNPL
KLWQELGPRGFFGFQVMVLSAPLLPLLNPIFWALLILWYGWEMEFVPKFFPGIIYYIAAI
EFLIGNFLFILSNAAGVYWVIDEMERKNERVFSYGIVKYAFLTPIYWVLMSIAALKALWQ
LITRPFYWEKTTHGLTEPDVVVQQMTGKDVGV

Enzyme Prediction     

No EC number prediction in MGYG000002817_00025.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	385	579	1.7e-25	0.9644670050761421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06427	CESA_like_2	1.38e-157	299	539	1	241	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
COG1215	BcsA	9.70e-52	247	668	10	428	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	5.57e-40	303	485	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06437	CESA_CaSu_A2	6.24e-26	299	527	1	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
cd06421	CESA_CelA_like	3.40e-22	299	531	1	233	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDM42782.1	0.0	1	692	1	692
QGQ96794.1	0.0	10	690	113	793
BBI30705.1	0.0	10	686	5	681
QJD86027.1	0.0	10	692	5	686
AJY77762.1	0.0	4	675	75	746

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	2.20e-20	296	542	46	294	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q9LJP4	2.33e-15	284	541	184	448	Xyloglucan glycosyltransferase 4 OS=Arabidopsis thaliana OX=3702 GN=CSLC4 PE=1 SV=1
Q9SB75	3.82e-14	284	540	208	475	Probable xyloglucan glycosyltransferase 5 OS=Arabidopsis thaliana OX=3702 GN=CSLC5 PE=1 SV=1
Q7PC69	3.37e-12	270	545	229	518	Probable xyloglucan glycosyltransferase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC3 PE=2 SV=1
Q9ZQB9	4.24e-12	298	565	240	514	Probable xyloglucan glycosyltransferase 12 OS=Arabidopsis thaliana OX=3702 GN=CSLC12 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
229	248
252	274
557	579
589	611
631	653