CAZyme Information: MGYG000002817_00570

Basic Information

• Species: Paenibacillus_B sp900539405
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_B; Paenibacillus_B sp900539405
• CAZyme ID: MGYG000002817_00570
• CAZy Family: GH85
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
939	MGYG000002817_2|CGC4	105586.61	4.6027

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002817	6425839	MAG	United States	North America

• Gene Location: Start: 165536; End: 168355 Strand: -

Full Sequence      

MSADNSSRSSNDKQHVREDWSAARETPRGPGQPYLHGYNAKELKAWSPDTDPYARFFRSR
VPLAKRIAPFAPTQAHPALTYQAKVMNLSADYDKEEWFGAYRYNDSFSRNVLKFWQYQDI
YAAWHGLPVYGSPEEDRQYGVVNLPNPAYTDAAHRNGVISLGGWFWPRDTDFGELVEETE
DGRFPVADKMIEMAEYFGFDGYFVNQEASISEEHAAQLMKMLKYMRESGLYFSWYDSLAP
NGELQYINFFNEMNAPWVLDQRDGRQPNDSIFINYAYTPERLENSNAYAREIGLDPYEAL
YAGVENDKFRFERGNELKSIFRDDEARTPRTSVALFGTDMVWHRGPNPSDPKMQQYIEHR
ERIYWSGATGNPAQSGRGIGSEGESWDGLAHFIPERSVIGSYPFVTRFNNGHGLAFFLNG
EAASRKGWNNVSAQELLPTWQWWVDSEGTPLAVDYDYSTAWNGGSSIKAEGLLDPGSSTD
IRLYKTDLPTDTDVLLSLTCKLDWSFAGKHTQDGERDSALLQLQLVLFYQDQPESPEVRP
FAAVPGTDWTTLALQLAGGTKRRIAAIGIRISSHTEKSVAVKLNLGELKLIEEAARMPVL
AAPAGFQVEHAYISEEQASIILSWQFADDSVIDNLWYYDLYRVKDGKREAIGRIFDDVFY
VKSVERLGETKLTFEAVAVNKEGVAGQPAVAVWSWGDGEAVDVQAGPYPAESLQPQFNTE
EDIVLEPGWSRYLNIRVEPAWADNLSLTWTSSNESVVTVNERGQITAVGPGKAIVTAATG
KLAGQEGPSLEIKVSVVAPEVAPEGGITLEAEHYDRSNGLFVPGSYVHVRDLHFANWMAF
DDVDFGAEGVTHITVRAAVLTEETRMLIHIGDAEGPLVADMDLPLKDGKLAPFYHNYSME
LAQRLTGRQTLYITFQNPNIRRWQIRDTGIADIDWIHFS

Enzyme Prediction     

No EC number prediction in MGYG000002817_00570.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH85	98	417	2.6e-82	0.9746031746031746

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4724	COG4724	4.74e-94	32	590	28	549	Endo-beta-N-acetylglucosaminidase D [Carbohydrate transport and metabolism].
pfam03644	Glyco_hydro_85	1.32e-76	105	413	3	291	Glycosyl hydrolase family 85. Family of endo-beta-N-acetylglucosaminidases. These enzymes work on a broad spectrum of substrates.
cd06547	GH85_ENGase	3.09e-74	104	448	19	339	Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins. The beta-1,4-glycosyl bond located between two N-acetylglucosamine residues is hydrolyzed such that N-acetylglucosamine 1 remains with the protein and N-acetylglucosamine 2 forms the reducing end of the released glycan. ENGase is a key enzyme in the processing of free oligosaccharides in the cytosol of eukaryotes. Oligosaccharides formed in the lumen of the endoplasmic reticulum are transported into the cytosol where they are catabolized by cytosolic ENGases and other enzymes, possibly to maximize the reutilization of the component sugars. ENGases have an eight-stranded alpha/beta barrel topology and are classified as a family 85 glycosyl hydrolase (GH85) domain. The GH85 ENGases are sequence-similar to the family 18 glycosyl hydrolases, also known as GH18 chitinases. An ENGase-like protein is also found in bacteria and is included in this alignment model.
cd04084	CBM6_xylanase-like	4.70e-14	808	938	2	123	Carbohydrate Binding Module 6 (CBM6); many are appended to glycoside hydrolase (GH) family 11 and GH43 xylanase domains. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family domains, including GH3, GH11, and GH43 domains. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB6s belonging to this family are Microbispora bispora GghA, a 1,4-beta-D-glucan glucohydrolase (GH3); Clostridium thermocellum xylanase U (GH11), and Penicillium purpurogenum ABF3, a bifunctional alpha-L-arabinofuranosidase/xylobiohydrolase (GH43). GH3 comprises enzymes with activities including beta-glucosidase (hydrolyzes beta-galactosidase) and beta-xylosidase (hydrolyzes 1,4-beta-D-xylosidase). GH11 family comprises enzymes with xylanase (endo-1,4-beta-xylanase) activity which catalyze the hydrolysis of beta-1,4 bonds of xylan, the major component of hemicelluloses, to generate xylooligosaccharides and xylose. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold.
pfam02368	Big_2	7.10e-08	724	794	11	77	Bacterial Ig-like domain (group 2). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in bacterial and phage surface proteins such as intimins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDM46912.1	0.0	1	939	1	939
QKW09085.1	4.88e-212	27	695	67	736
QCX74202.1	3.01e-207	28	695	50	714
QEV57764.1	2.69e-205	28	695	50	714
QDQ09335.1	4.79e-203	28	695	50	714

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VTF_A	3.27e-75	41	678	19	608	X-raycrystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae],2VTF_B X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae]
3FHA_A	5.56e-75	41	678	14	603	ChainA, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_C Chain C, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
3FHQ_A	7.67e-75	41	678	14	603	ChainA, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_F Chain F, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
2W91_A	3.92e-56	41	696	18	635	Structureof a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D. [Streptococcus pneumoniae TIGR4],2W92_A Structure of a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D, in complex with NAG-thiazoline. [Streptococcus pneumoniae TIGR4]
3GDB_A	9.09e-55	41	696	169	786	Crystalstructure of Spr0440 glycoside hydrolase domain, Endo-D from Streptococcus pneumoniae R6 [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1L251	2.68e-26	115	501	133	478	Cytosolic endo-beta-N-acetylglucosaminidase OS=Danio rerio OX=7955 GN=engase PE=2 SV=1
Q8BX80	2.67e-25	115	570	147	565	Cytosolic endo-beta-N-acetylglucosaminidase OS=Mus musculus OX=10090 GN=Engase PE=1 SV=1
P0C7A1	4.58e-25	41	476	89	466	Cytosolic endo-beta-N-acetylglucosaminidase OS=Gallus gallus OX=9031 GN=ENGASE PE=1 SV=1
Q8NFI3	2.33e-23	142	503	169	502	Cytosolic endo-beta-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=ENGASE PE=1 SV=1
Q9SRL4	3.78e-20	121	503	95	468	Cytosolic endo-beta-N-acetylglucosaminidase 2 OS=Arabidopsis thaliana OX=3702 GN=ENGASE2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999829	0.000115	0.000040	0.000002	0.000001	0.000031

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002817_00570.