CAZyme Information: MGYG000002817_01460

Basic Information

• Species: Paenibacillus_B sp900539405
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_B; Paenibacillus_B sp900539405
• CAZyme ID: MGYG000002817_01460
• CAZy Family: GH18
• CAZyme Description: Endo-beta-N-acetylglucosaminidase F2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	MGYG000002817_5|CGC4	36956.85	4.8714

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002817	6425839	MAG	United States	North America

• Gene Location: Start: 81342; End: 82319 Strand: -

Full Sequence      

MKKTSMLLILSTVLILSLMSGSTITASPSTSLGNELTEAQKAPVMMAYYRTWRDVTMPHD
ANSTLPYPNVTAMTDIPEEIDIVSVFHYVKPGTDEQRFWDTLRDTYVPVLHERQTKVIRT
IDIRELYNVPSVGTMPTATEYDDHAQSLIDKYVTPYNLDGLDIDMEETLTQEKETKAFGV
FKALSQRLGPMSNSGKLLIYDTNKDNHSLFRKVAPFCDYLFLQAYGRDPGRLDSTWATYK
NTILPDQFLPGISFQEELGANWGDAQEPFETSRAYKYAVWQPEDGPKGGMFIYAIDRDGK
KYGDNTITKTDFSWTKKLIDVLKNN

Enzyme Prediction     

No EC number prediction in MGYG000002817_01460.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06542	GH18_EndoS-like	2.31e-56	43	310	1	253	Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain. Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522). Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and EndoH from Flavobacterium meningosepticum, and EndoE from Enterococcus faecalis. EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues. EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.
pfam16141	DUF4849	8.96e-09	62	298	45	301	Putative glycoside hydrolase Family 18, chitinase_18. This DUF is likely to be a form of glycosyl hydrolase from CAZy family 18, possibly chitinase 18. This would have the EC number of EC:3.2.1.14.
cd00598	GH18_chitinase-like	1.80e-04	45	225	1	176	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDM44162.1	1.74e-225	2	324	3	325
SYX83265.1	1.57e-214	1	325	1	325
ALS02650.1	2.41e-154	41	325	33	318
CCO12584.1	1.30e-153	32	323	23	315
ALS36881.1	3.15e-153	45	325	1	282

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KPL_A	2.52e-74	44	322	31	295	CrystalStructure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris in apo form [Cordyceps militaris CM01],6KPM_A Crystal Structure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris in complex with L-fucose [Cordyceps militaris CM01]
6KPN_A	4.03e-73	44	322	31	295	CrystalStructure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris D154N/E156Q mutant in complex with fucosyl-N-acetylglucosamine [Cordyceps militaris CM01],6KPO_A Crystal Structure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris D154N/E156Q mutant in complex with fucosyl-N-acetylglucosamine-Asn [Cordyceps militaris CM01]
7PUJ_A	6.54e-64	33	319	4	291	ChainA, Beta-N-acetylhexosaminidase [Enterococcus faecalis],7PUK_A Chain A, Beta-N-acetylhexosaminidase [Enterococcus faecalis],7PUK_C Chain C, Beta-N-acetylhexosaminidase [Enterococcus faecalis]
6E58_A	6.76e-42	32	318	12	338	Crystalstructure of Streptococcus pyogenes endo-beta-N-acetylglucosaminidase (EndoS2) [Streptococcus pyogenes M49 591],6E58_B Crystal structure of Streptococcus pyogenes endo-beta-N-acetylglucosaminidase (EndoS2) [Streptococcus pyogenes M49 591],6MDS_A Crystal structure of Streptococcus pyogenes endo-beta-N-acetylglucosaminidase (EndoS2) with complex biantennary glycan [Streptococcus pyogenes],6MDS_B Crystal structure of Streptococcus pyogenes endo-beta-N-acetylglucosaminidase (EndoS2) with complex biantennary glycan [Streptococcus pyogenes],6MDV_A Crystal structure of Streptococcus pyogenes endo-beta-N-acetylglucosaminidase (EndoS2) with high-mannose glycan [Streptococcus pyogenes],6MDV_B Crystal structure of Streptococcus pyogenes endo-beta-N-acetylglucosaminidase (EndoS2) with high-mannose glycan [Streptococcus pyogenes]
4NUY_A	3.03e-34	43	322	15	347	Crystalstructure of EndoS, an endo-beta-N-acetyl-glucosaminidase from Streptococcus pyogenes [Streptococcus pyogenes serotype M1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36912	3.35e-58	44	322	62	333	Endo-beta-N-acetylglucosaminidase F2 OS=Elizabethkingia meningoseptica OX=238 GN=endOF2 PE=1 SV=1
B7GPC7	2.61e-50	46	319	54	341	Endo-beta-N-acetylglucosaminidase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) OX=391904 GN=Blon_2468 PE=1 SV=1
P36913	6.22e-06	73	296	65	314	Endo-beta-N-acetylglucosaminidase F3 OS=Elizabethkingia meningoseptica OX=238 GN=endOF3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001514	0.717390	0.280293	0.000357	0.000225	0.000199

TMHMM  Annotations     

start	end
7	26