CAZyme Information: MGYG000002817_03068

Basic Information

• Species: Paenibacillus_B sp900539405
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_B; Paenibacillus_B sp900539405
• CAZyme ID: MGYG000002817_03068
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1573	MGYG000002817_16|CGC1	171667.07	6.4473

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002817	6425839	MAG	United States	North America

• Gene Location: Start: 31382; End: 36103 Strand: -

Full Sequence      

MTKSQQTQAATGLEIAVIGMAGRFPGARNIEEYWDNLKNGKESVRFFSDEELEAAGVESE
LIRNPRYVKAKAVVPDAEWFDSDFFDYSPREAEVIDPQLRIFHECAWEALEHAGYDPEQT
NGAIGLFAGASASIYWQLVAMLSRSESTAEQFAALALSDKDFLSTRISHKLNLKGPSVNV
DSACSTSLLAIHMACRALLTGECRMALAGGVTVTVPRTEGYLYEEGMVSSPDGHCRAFDA
KAKGTVGGEGAGIVVLKPLKQAIADGDCIYAVIKGSASNNDGTRKVGFSAPSIEGQAEVI
RAAQRMGRIAPESISYVEAHGTGTALGDPVEIEALKLAFQTEKTGFCRIGSVKTNIGHLN
SAAGVAAFIKTVLSLHHKQLPPSLHFETPNPKIDFANSPFLVNTELIPWTNEPYPLRAGV
SSFGIGGTNIHIVLEEAPPQPDGDEGRAAQLVLLSAKTESGLEQATARLRAHLREHPGLP
LPDVAYTLQIGRRAFRHRRMFVCSSAEEARELLETLPPERVHTRSCDNDQARLVFMFPGQ
GAQYVNMGLDLYMREPDFRETVDRCCGIVRPLLDADLKELLYPAGNDAAADCAERIKQTD
VTQPLMFIFSYALAQLLMKWGLKPSALIGHSAGEYVAACLAGVMTLEEALELVALRGRLM
HGMPPGAMLSVPLPEQELKPLLADGVSIAAVNGAALCVASGPHDEIDRLERQLAEAGHAC
SRLHTSHAFHSAMMEPIMEAFRRKVSEMTLRAPSIPYISNVTGTWIKAEEAIEPEYWIRH
LRGTVRFADGLRELLRDGKAVFVEAGPGNALSAFVRRHPDKTARHAAVNLVRHPKEQARD
DEYLLQQVGRLWLEGARPDWRAFHAGERRKRTALPTYPFERRRYWVDPPFEIDILKQGLT
RKRNPDSRPQDSAGFAKKNSVREWLYAPVWERSFLQEAGAAGSEHPGSLWVVFSPEDGII
PRLVARMREAGRDVVAVHPSDSFSPLNDGAYRIHPGEPEHYERLLRTLTEAGRPPHRIIH
AWLTAEAVETTEAADTGKAEARIPSAEDRALDRGYYSLLALARAIGSCGLQEGVRLAVVT
SHMQEVTGDERLQPEQAAAIGACLVIPQEYGHVRCRSIDIADSFRPSEPERQQALVERLH
AELAAPSDDLFVAYRGAHRWVQKYARLPEPAADTGLRKHGVYLITGGLGGIGLTLAEHLA
KTVQAKLILVGRSGLESAGADKRGALGELERHGSEVLVCKADVCDEARMEQVAAEAVARF
GAIHGVIHAAGISDGALIQRRTREMDERALAAKVEGTRVLDRVLERVMGPAGMRLDFLVL
CSSLTAALGGVGQAGYCAANAYLDAYACSKRAQGGTHVVAIAWDGWQSVGMAAAAELEIA
AMTAQAGVRAQGPDKLTRLLPEEGVAVFRQALACRRPQVLVSTTDLPQRVQAARASSLHS
LMNKEGDGTGPQAARPDVSAGHASPEDELEQTLADLWRDYLGIEQVGLHDNFFELGATSL
DIIQMNTKLQRALGREVAVVDMFTHPTIHSLAESLRQGAHKEAAPPEETADRSERIHEGK
NRLKQRLQKRERT

Enzyme Prediction     

No EC number prediction in MGYG000002817_03068.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00833	PKS	0.0	14	434	2	421	polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations. PKSs can be divided into 2 groups, modular type I PKSs consisting of one or more large multifunctional proteins and iterative type II PKSs, complexes of several monofunctional subunits.
COG3321	PksD	0.0	10	1039	1	1048	Acyl transferase domain in polyketide synthase (PKS) enzymes [Secondary metabolites biosynthesis, transport and catabolism].
smart00825	PKS_KS	9.50e-149	15	436	1	298	Beta-ketoacyl synthase. The structure of beta-ketoacyl synthase is similar to that of the thiolase family and also chalcone synthase. The active site of beta-ketoacyl synthase is located between the N and C-terminal domains.
smart00827	PKS_AT	4.22e-115	536	828	1	292	Acyl transferase domain in polyketide synthase (PKS) enzymes.
TIGR02813	omega_3_PfaA	1.96e-100	15	815	9	876	polyketide-type polyunsaturated fatty acid synthase PfaA. Members of the seed for this alignment are involved in omega-3 polyunsaturated fatty acid biosynthesis, such as the protein PfaA from the eicosapentaenoic acid biosynthesis operon in Photobacterium profundum strain SS9. PfaA is encoded together with PfaB, PfaC, and PfaD, and the functions of the individual polypeptides have not yet been described. More distant homologs of PfaA, also included with the reach of this model, appear to be involved in polyketide-like biosynthetic mechanisms of polyunsaturated fatty acid biosynthesis, an alternative to the more familiar iterated mechanism of chain extension and desaturation, and in most cases are encoded near genes for homologs of PfaB, PfaC, and/or PfaD.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAY90071.1	2.53e-293	14	888	1212	2095
BAZ00088.1	3.99e-293	14	901	1213	2109
BAZ75991.1	3.99e-293	14	901	1213	2109
BAY30132.1	5.62e-293	14	901	1215	2111
AFY93865.1	6.71e-265	2	889	948	1865

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7M7I_A	1.65e-191	5	1535	25	1485	ChainA, EryAI [Saccharopolyspora erythraea],7M7I_B Chain B, EryAI [Saccharopolyspora erythraea]
7M7J_A	1.65e-191	5	1535	25	1485	ChainA, EryAI [Saccharopolyspora erythraea],7M7J_B Chain B, EryAI [Saccharopolyspora erythraea]
7M7F_A	6.95e-190	5	1535	25	1485	ChainA, EryAI,6-deoxyerythronolide-B synthase EryA3, modules 5 and 6 chimera [Saccharopolyspora erythraea],7M7F_B Chain B, EryAI,6-deoxyerythronolide-B synthase EryA3, modules 5 and 6 chimera [Saccharopolyspora erythraea],7M7G_A Chain A, EryAI,6-deoxyerythronolide-B synthase EryA3, modules 5 and 6 chimera [Saccharopolyspora erythraea],7M7G_B Chain B, EryAI,6-deoxyerythronolide-B synthase EryA3, modules 5 and 6 chimera [Saccharopolyspora erythraea],7M7H_A Chain A, EryAI,6-deoxyerythronolide-B synthase EryA3, modules 5 and 6 chimera [Saccharopolyspora erythraea],7M7H_B Chain B, EryAI,6-deoxyerythronolide-B synthase EryA3, modules 5 and 6 chimera [Saccharopolyspora erythraea]
7S6C_A	1.74e-180	15	1536	34	1557	ChainA, 6-deoxyerythronolide-B synthase EryA2, modules 3 and 4, Lsd14 Polyketide synthase fusion [synthetic construct],7S6C_B Chain B, 6-deoxyerythronolide-B synthase EryA2, modules 3 and 4, Lsd14 Polyketide synthase fusion [synthetic construct],7S6C_C Chain C, 6-deoxyerythronolide-B synthase EryA2, modules 3 and 4, Lsd14 Polyketide synthase fusion [synthetic construct],7S6C_D Chain D, 6-deoxyerythronolide-B synthase EryA2, modules 3 and 4, Lsd14 Polyketide synthase fusion [synthetic construct],7S6D_A Chain A, 6-deoxyerythronolide-B synthase EryA2, modules 3 and 4, Lsd14 Polyketide synthase fusion [synthetic construct],7S6D_B Chain B, 6-deoxyerythronolide-B synthase EryA2, modules 3 and 4, Lsd14 Polyketide synthase fusion [synthetic construct],7S6D_C Chain C, 6-deoxyerythronolide-B synthase EryA2, modules 3 and 4, Lsd14 Polyketide synthase fusion [synthetic construct]
4MZ0_A	2.44e-175	2	887	28	937	ChainA, CurL [Moorena producens 3L],4MZ0_B Chain B, CurL [Moorena producens 3L]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WQE1	2.21e-226	15	888	8	897	Phenolphthiocerol/phthiocerol polyketide synthase subunit E OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ppsE PE=1 SV=1
P9WQE0	2.21e-226	15	888	8	897	Phenolphthiocerol/phthiocerol polyketide synthase subunit E OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=ppsE PE=3 SV=1
Q7TXL6	2.21e-226	15	888	8	897	Phenolphthiocerol/phthiocerol polyketide synthase subunit E OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=ppsE PE=1 SV=1
Q03131	5.26e-185	2	1535	494	1957	6-deoxyerythronolide-B synthase EryA1, modules 1 and 2 OS=Saccharopolyspora erythraea OX=1836 GN=eryA PE=1 SV=1
Q07017	1.71e-163	9	1538	1683	3217	Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus OX=1890 GN=orfB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997259	0.002706	0.000062	0.000008	0.000003	0.000009

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002817_03068.