CAZyme Information: MGYG000002817_05264

Basic Information

• Species: Paenibacillus_B sp900539405
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_B; Paenibacillus_B sp900539405
• CAZyme ID: MGYG000002817_05264
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462		53094.93	9.2642

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002817	6425839	MAG	United States	North America

• Gene Location: Start: 32717; End: 34105 Strand: -

Full Sequence      

MYYVIIVNSIYFGIMLFSFKSIFSIVRRKRYALRSNLAGSEHVPPVSLLVPAYNEELTII
ENVKSLMTLNYPTYEIIVVNDGSSDNTLQVMIEEFGMYRMDNLAVRYAVNCTKFRGVYYN
PEYPNLYLIDKANGGKADSLNAGINFSHYPLISSIDADSLLEKDSLIQMANLYMSNPEEY
VAIGGNVRIANGCKIENGTVTEVRLPKKWWPMFQTLEYLKAFLGGRIGWGAINGLIIVSG
AFGLFRKDYVIKVGGYREGYPGEDMNIIIKLHRYMLENKLPYRVAFCPEAVCWTQAPDTY
HILSNQRKRWGRGNLKNMIENYDMAFRPKYKVFGLLSMPYTILFEALNPYFKVTGLLALI
GYAFLDMTQWPIVLIFMLINFLSGMLLAIGSLLLEEIAFKRYPRISDLFRMLAFSVLMFF
GYRQLGGLWRIQGHIQYFQNNNSWGAMTRQSWQEESKPVKSA

Enzyme Prediction     

No EC number prediction in MGYG000002817_05264.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	44	313	7e-24	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	4.63e-62	48	264	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	8.20e-46	1	431	16	405	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	8.30e-41	1	393	21	355	N-glycosyltransferase; Provisional
pfam13641	Glyco_tranf_2_3	2.85e-22	44	313	2	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
PRK14583	hmsR	1.32e-21	44	393	75	376	poly-beta-1,6 N-acetyl-D-glucosamine synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDM45484.1	0.0	1	462	1	462
SYX87543.1	8.54e-308	1	462	7	468
AWB45147.1	1.66e-255	1	462	1	461
QLG39516.1	3.93e-250	2	462	5	465
QKS60007.1	4.07e-250	2	462	5	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	4.36e-07	46	176	7	112	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	3.02e-06	43	201	4	135	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6P61_A	4.89e-06	44	177	13	121	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HKQ0	1.63e-27	34	329	35	286	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1
Q8GLC5	3.04e-27	37	329	38	286	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q5HCN1	1.47e-24	23	329	25	286	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q6GDD8	1.47e-24	23	329	25	286	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q7A351	1.47e-24	23	329	25	286	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999561	0.000463	0.000004	0.000001	0.000001	0.000001

TMHMM  Annotations     

start	end
4	26
222	244
343	365
372	394
409	431